SLIT3 recombinant protein
SLIT3 protein
Purity
> 90% pure
Synonyms
SLIT3; SLIT3 protein; Slit homolog 3 protein; Human SLIT3 protein; Recombinant human Slit 3 homolog protein; KIAA0814 protein; MEGF5 protein; SLIL2 ORF protein; Multiple epidermal growth factor-like domains protein 5; Multiple EGF-like domains protein 5; SLIT3 recombinant protein
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied as liquid in Tris-based buffer with 50% glycerol
Sequence
CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAG LKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG
Protein Type
Recombinant
Biological Significance
Slit refers to a family of related genes which encode a corresponding set of secreted proteins. The protein encoded by the slit3 gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Due to its pivotal role in controlling cell migration, abnormalities or absences in the expression of Slit1, Slit2 and Slit3 are associated with a variety of cancers. In particular, Slit-Robo interaction has been implicated in reproductive and hormone dependent cancers, particularly in females.
Expression System
E Coli
Tag
N terminal His-tag and C terminal Myc-tag
Preparation and Storage
Store at 4 degree C short term. Aliquot and store at -70 degree C for long term storage. Avoid repeated freeze/thaw cycles.
Related Product Information for SLIT3 recombinant protein
Recombinant Human Slit homolog 3 protein
Product Categories/Family for SLIT3 recombinant protein
Similar Products
Product Notes
The SLIT3 (Catalog #AAA5303883) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CPTKCTCSAA SVDCHGLGLR AVPRGIPRNA ERLDLDRNNI TRITKMDFAG LKNLRVLHLE DNQVSVIERG AFQDLKQLER LRLNKNKLQV LPELLFQSTP KLTRLDLSEN QIQGIPRKAF RG . It is sometimes possible for the material contained within the vial of "SLIT3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
