Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc transporter ZIP4 (Slc39a4) Recombinant Protein | Slc39a4 recombinant protein

Recombinant Mouse Zinc transporter ZIP4 (Slc39a4)

Gene Names
Slc39a4; ZIP4; AWMS2; AU041686; 1600025H15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc transporter ZIP4 (Slc39a4); Recombinant Mouse Zinc transporter ZIP4 (Slc39a4); Slc39a4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-660aa; full length protein
Sequence
RPRNLLSLLALGQGALDRLELDGLLNTLVARVHCTDGPCEKCLSVENVLALGKPDKPQPA PESVLESRHIIYLSAAAALYLNNPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLSQL LQKIEAHAASQPTGEKTCVDLPQLLEEAEAAGVSKSAGLVLTALLDHVINGSCFQGLPSP QYFVDFVFRLHSSDPPNITLHELENLMHHLGVGGEDHSDHDDHGDHADHSHPDRKASHQD SELHTPHNSNSSVWDTLCLSAKDIMAVYGLSEEAGVSPQAWAQLTPALVQQQLSGACSPY PTIRIQDQLSQTERYLYGSLATLLICLCAVFGLLLLTCAKCSTATHYIMQTFLSLAVGAL TGDALLHLIPKVLGLHTHGGEGHTHEEEVGVGGQATWRLLAVLGGFYIFFLFESFFNLLL PRDQDSEKDGPCSHGGHSHGISLQLAPSNLRQSKQTHESSRSDLVAEETPELLNPETRRL RAELRLLPYLITLGDAVHNFADGLAVGAAFSSSWKTGLATSLAVFCHELPHELGDFAALL HAGLSVKRALLLNLASALTAFAGLYVALAVGVGEEGEAWILAVATGLFLYVALCDMLPAM MNVRDQRPWLLFLLHNVGLLGGWTVLLLLSLYEDNITF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc39a4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,171 Da
NCBI Official Full Name
zinc transporter ZIP4
NCBI Official Synonym Full Names
solute carrier family 39 (zinc transporter), member 4
NCBI Official Symbol
Slc39a4
NCBI Official Synonym Symbols
ZIP4; AWMS2; AU041686; 1600025H15Rik
NCBI Protein Information
zinc transporter ZIP4
UniProt Protein Name
Zinc transporter ZIP4
Protein Family
UniProt Gene Name
Slc39a4
UniProt Synonym Gene Names
Zip4; mAWMS2; ZIP-4
UniProt Entry Name
S39A4_MOUSE

Uniprot Description

SLC39A4: Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability. Defects in SLC39A4 are the cause of acrodermatitis enteropathica zinc-deficiency type (AEZ). AEZ is a rare autosomal recessive disease caused by the inability to absorb sufficient zinc. The clinical features are growth retardation, immune system dysfunction, alopecia, severe dermatitis, diarrhea and occasionally mental disorders. All these manifestations are reversible with zinc supplementation. Without zinc therapy this disease is fatal. Belongs to the ZIP transporter (TC 2.A.5) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Membrane protein, multi-pass

Cellular Component: apical plasma membrane; cytoplasmic membrane-bound vesicle; endosome; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: metal ion transmembrane transporter activity; zinc ion transmembrane transporter activity

Biological Process: cellular zinc ion homeostasis; ion transport; metal ion transport; transmembrane transport; transport; zinc ion transport

Disease: Acrodermatitis Enteropathica, Zinc-deficiency Type

Research Articles on Slc39a4

Similar Products

Product Notes

The Slc39a4 slc39a4 (Catalog #AAA7030109) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-660aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc39a4 slc39a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPRNLLSLLA LGQGALDRLE LDGLLNTLVA RVHCTDGPCE KCLSVENVLA LGKPDKPQPA PESVLESRHI IYLSAAAALY LNNPEKTCKD IQAGLLASHV DDYLATLESP EAMTLGLSQL LQKIEAHAAS QPTGEKTCVD LPQLLEEAEA AGVSKSAGLV LTALLDHVIN GSCFQGLPSP QYFVDFVFRL HSSDPPNITL HELENLMHHL GVGGEDHSDH DDHGDHADHS HPDRKASHQD SELHTPHNSN SSVWDTLCLS AKDIMAVYGL SEEAGVSPQA WAQLTPALVQ QQLSGACSPY PTIRIQDQLS QTERYLYGSL ATLLICLCAV FGLLLLTCAK CSTATHYIMQ TFLSLAVGAL TGDALLHLIP KVLGLHTHGG EGHTHEEEVG VGGQATWRLL AVLGGFYIFF LFESFFNLLL PRDQDSEKDG PCSHGGHSHG ISLQLAPSNL RQSKQTHESS RSDLVAEETP ELLNPETRRL RAELRLLPYL ITLGDAVHNF ADGLAVGAAF SSSWKTGLAT SLAVFCHELP HELGDFAALL HAGLSVKRAL LLNLASALTA FAGLYVALAV GVGEEGEAWI LAVATGLFLY VALCDMLPAM MNVRDQRPWL LFLLHNVGLL GGWTVLLLLS LYEDNITF. It is sometimes possible for the material contained within the vial of "Zinc transporter ZIP4 (Slc39a4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.