Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sodium-dependent phosphate transport protein 2C (SLC34A3) Recombinant Protein | SLC34A3 recombinant protein

Recombinant Human Sodium-dependent phosphate transport protein 2C (SLC34A3), partial

Gene Names
SLC34A3; HHRH; NPTIIc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sodium-dependent phosphate transport protein 2C (SLC34A3); Recombinant Human Sodium-dependent phosphate transport protein 2C (SLC34A3); partial; SLC34A3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-76. Fragment at the N-terminal.
Sequence
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKA
Sequence Length
76
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,550 Da
NCBI Official Full Name
sodium-dependent phosphate transport protein 2C
NCBI Official Synonym Full Names
solute carrier family 34 member 3
NCBI Official Symbol
SLC34A3
NCBI Official Synonym Symbols
HHRH; NPTIIc
NCBI Protein Information
sodium-dependent phosphate transport protein 2C
UniProt Protein Name
Sodium-dependent phosphate transport protein 2C
UniProt Gene Name
SLC34A3
UniProt Synonym Gene Names
NPT2C; NPTIIC; Sodium-phosphate transport protein 2C; Na(+)/Pi cotransporter 2C; NaPi-2c

NCBI Description

This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.[provided by RefSeq, Apr 2010]

Uniprot Description

May be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.

Research Articles on SLC34A3

Similar Products

Product Notes

The SLC34A3 slc34a3 (Catalog #AAA7097133) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-76. Fragment at the N-terminal. The amino acid sequence is listed below: MPSSLPGSQV PHPTLDAVDL VEKTLRNEGT SSSAPVLEEG DTDPWTLPQL KDTSQPWKEL RVAGRLRRVA GSVLKA. It is sometimes possible for the material contained within the vial of "Sodium-dependent phosphate transport protein 2C (SLC34A3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.