Very long-chain acyl-CoA synthetase (Slc27a2) Recombinant Protein | Slc27a2 recombinant protein
Recombinant Rat Very long-chain acyl-CoA synthetase (Slc27a2), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Very long-chain acyl-CoA synthetase (Slc27a2); Recombinant Rat Very long-chain acyl-CoA synthetase (Slc27a2); partial; Slc27a2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
289-620, Fragment at the C-terminal, provide the last intracellular domain.
Sequence
RSKFSASQFWDDCRKYNATVIQYIGELLRYLCNTPQKPNDRDHKVKIALGNGLRGDVWREFIKRFGDIHIYEFYASTEGNIGFMNYPRKIGAVGRENYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPKGEVGLLICKITELTPFFGYAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDRENFIYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASIKMKENYEFNGKKLFQHISEYLPSYSRPRFLRIQDTIEITGTFKHRKVTLMEEGFNPSVIKDTLYFMDDTEKTYVPMTEDIYNAIIDKTLKL
Sequence Length
620
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,694 Da
NCBI Official Full Name
very long-chain acyl-CoA synthetase
NCBI Official Synonym Full Names
solute carrier family 27 member 2
NCBI Official Symbol
Slc27a2
NCBI Protein Information
very long-chain acyl-CoA synthetase
UniProt Protein Name
Very long-chain acyl-CoA synthetase
Protein Family
UniProt Gene Name
Slc27a2
UniProt Synonym Gene Names
Acsvl1; Facvl1; Fatp2; Vlacs; Vlcs; VLACS; VLCS; FATP-2
NCBI Description
has very long-chain acyl-CoA synthetase activity; may play a role in fatty acid metabolism [RGD, Feb 2006]
Uniprot Description
Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precursors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes ().
Research Articles on Slc27a2
Similar Products
Product Notes
The Slc27a2 slc27a2 (Catalog #AAA963019) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 289-620, Fragment at the C-terminal, provide the last intracellular domain. The amino acid sequence is listed below: RSKFSASQFW DDCRKYNATV IQYIGELLRY LCNTPQKPND RDHKVKIALG NGLRGDVWRE FIKRFGDIHI YEFYASTEGN IGFMNYPRKI GAVGRENYLQ KKVVRHELIK YDVEKDEPVR DANGYCIKVP KGEVGLLICK ITELTPFFGY AGGKTQTEKK KLRDVFKKGD VYFNSGDLLM IDRENFIYFH DRVGDTFRWK GENVATTEVA DIVGLVDFVE EVNVYGVPVP GHEGRIGMAS IKMKENYEFN GKKLFQHISE YLPSYSRPRF LRIQDTIEIT GTFKHRKVTL MEEGFNPSVI KDTLYFMDDT EKTYVPMTED IYNAIIDKTL KL . It is sometimes possible for the material contained within the vial of "Very long-chain acyl-CoA synthetase (Slc27a2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
