Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24) Recombinant Protein | slc25a24 recombinant protein

Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24)

Gene Names
slc25a24; zgc:92470
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24); Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24); slc25a24 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-477aa; full length protein
Sequence
MHQLIRKFVFTESHCLEEEDNTKSFAELFEKLDVNKDGKVDVSELKTGLAAMGFSMGKGE AQKIVTSGDTDKDEGLDFEEFSKYLKEHEKKLRLTFKSLDKNEDGRVDAKEIQQSLKDLG INLSDKDAEKILHSIDVDGTMTLDWNEWREHFLFNPAEDLQQIIRYWKKSTVLDIGDSLT IPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFK QMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSKDGGKVQSHERFMAGSLAG ATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAG IDLAVYETLKNTWLSHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAMASM EGSEQVSMSKLVKKIMQKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGISK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for slc25a24 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,356 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-1
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
NCBI Official Symbol
slc25a24
NCBI Official Synonym Symbols
zgc:92470
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-1
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-1
UniProt Gene Name
slc25a24
UniProt Synonym Gene Names
scamc1
UniProt Entry Name
SCMC1_DANRE

Uniprot Description

Calcium-dependent mitochondrial solute carrier. Mediates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP against phosphate ions, catalyzing the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive when cytosolic calcium levels are low, and is activated by an increase in cytosolic calcium levels. May play a role in protecting cells against oxidative stress-induced cell death, probably by promoting the formation of calcium-phosphate precipitates in the mitochondrial matrix, and thereby buffering calcium levels in the mitochondrial matrix ().

Similar Products

Product Notes

The slc25a24 slc25a24 (Catalog #AAA7029894) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-477aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the slc25a24 slc25a24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHQLIRKFVF TESHCLEEED NTKSFAELFE KLDVNKDGKV DVSELKTGLA AMGFSMGKGE AQKIVTSGDT DKDEGLDFEE FSKYLKEHEK KLRLTFKSLD KNEDGRVDAK EIQQSLKDLG INLSDKDAEK ILHSIDVDGT MTLDWNEWRE HFLFNPAEDL QQIIRYWKKS TVLDIGDSLT IPDEFTEEEK TTGMWWKQLA AGGVAGAVSR TGTAPLDRMK VFMQVHSSKT NKISLVNGFK QMIKEGGVAS LWRGNGVNVI KIAPETAIKF MAYEQYKKLL SKDGGKVQSH ERFMAGSLAG ATAQTAIYPM EVMKTRLTLR KTGQYSGMFD CAKKILRKEG VKAFYKGYVP NILGIIPYAG IDLAVYETLK NTWLSHYAKD TANPGVLVLL GCGTISSTCG QLASYPLALI RTRMQAMASM EGSEQVSMSK LVKKIMQKEG FFGLYRGILP NFMKVIPAVS ISYVVYEYMR SGLGISK. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.