Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Solute carrier family 22 member 1 (SLC22A1) Recombinant Protein | SLC22A1 recombinant protein

Recombinant Rabbit Solute carrier family 22 member 1 (SLC22A1), partial

Gene Names
SLC22A1; OCT1; RBOCT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Solute carrier family 22 member 1 (SLC22A1); Recombinant Rabbit Solute carrier family 22 member 1 (SLC22A1); partial; SLC22A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-554
Sequence
MPTVDDVLEQVGEFGWFQKRTFLFLCLISAILAPIYLGIVFLGFTPDHRCRSPGVDELSQRCGWSPEEELNYTVPGLGATDGAFVRQCMRYEVDWNQSSLGCVDPLASLAPNRSHLPLGPCQHGWVYDTPGSSIVTEFNLVCADAWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKLCLLLTTLINAVSGVLTAVAPDYTSMLLFRLLQGLVSKGSWMSGYTLITEFVGSGYRRTVAILYQVAFSVGLVALSGVAYAIPNWRWLQLTVSLPTFLCLFYYWCVPESPRWLLSQKRNTDAVKIMDNIAQKNGKLPPADLKMLSLDEDVTEKLSPSLADLFRTPNLRKHTFILMFLWFTCSVLYQGLILHMGATGGNVYLDFFYSSLVEFPAAFVILVTIDRVGRIYPMAASNLAAGVASVILIFVPQDLHWLTIVLSCVGRMGATIVLQMICLVNAELYPTFVRNLGVMVCSALCDVGGIITPFMVFRLMEVWQPLPLIVFGVLGLLAGGMTLLLPETKGVALPETIEDAENLRRKAKPKESKIYLQVQTSELKGP
Sequence Length
554
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,288 Da
NCBI Official Full Name
solute carrier family 22 member 1
NCBI Official Symbol
SLC22A1
NCBI Official Synonym Symbols
OCT1; RBOCT1
NCBI Protein Information
solute carrier family 22 member 1
UniProt Protein Name
Solute carrier family 22 member 1
Protein Family
UniProt Gene Name
SLC22A1
UniProt Synonym Gene Names
OCT1

Uniprot Description

Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.

Similar Products

Product Notes

The SLC22A1 slc22a1 (Catalog #AAA1098313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-554. The amino acid sequence is listed below: MPTVDDVLEQ VGEFGWFQKR TFLFLCLISA ILAPIYLGIV FLGFTPDHRC RSPGVDELSQ RCGWSPEEEL NYTVPGLGAT DGAFVRQCMR YEVDWNQSSL GCVDPLASLA PNRSHLPLGP CQHGWVYDTP GSSIVTEFNL VCADAWKVDL FQSCVNLGFF LGSLGVGYIA DRFGRKLCLL LTTLINAVSG VLTAVAPDYT SMLLFRLLQG LVSKGSWMSG YTLITEFVGS GYRRTVAILY QVAFSVGLVA LSGVAYAIPN WRWLQLTVSL PTFLCLFYYW CVPESPRWLL SQKRNTDAVK IMDNIAQKNG KLPPADLKML SLDEDVTEKL SPSLADLFRT PNLRKHTFIL MFLWFTCSVL YQGLILHMGA TGGNVYLDFF YSSLVEFPAA FVILVTIDRV GRIYPMAASN LAAGVASVIL IFVPQDLHWL TIVLSCVGRM GATIVLQMIC LVNAELYPTF VRNLGVMVCS ALCDVGGIIT PFMVFRLMEV WQPLPLIVFG VLGLLAGGMT LLLPETKGVA LPETIEDAEN LRRKAKPKES KIYLQVQTSE LKGP. It is sometimes possible for the material contained within the vial of "Solute carrier family 22 member 1 (SLC22A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.