Excitatory amino acid transporter 1 (Slc1a3) Recombinant Protein | Slc1a3 recombinant protein
Recombinant Mouse Excitatory amino acid transporter 1 (Slc1a3), partial
Gene Names
Slc1a3; Gmt1; Eaat1; GLAST; GLU-T; GluT-1; MGluT1; GLAST-1; AI504299; B430115D02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Excitatory amino acid transporter 1 (Slc1a3); Recombinant Mouse Excitatory amino acid transporter 1 (Slc1a3); partial; Slc1a3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
146-237
Sequence
HPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPPNLVEACFKQFKTSYEKRSFKVPIQSNETLLGAVINNVSEAMETLTRIREEMVPVPGS
Sequence Length
543
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,622 Da
NCBI Official Full Name
excitatory amino acid transporter 1
NCBI Official Synonym Full Names
solute carrier family 1 (glial high affinity glutamate transporter), member 3
NCBI Official Symbol
Slc1a3
NCBI Official Synonym Symbols
Gmt1; Eaat1; GLAST; GLU-T; GluT-1; MGluT1; GLAST-1; AI504299; B430115D02Rik
NCBI Protein Information
excitatory amino acid transporter 1
UniProt Protein Name
Excitatory amino acid transporter 1
Protein Family
UniProt Gene Name
Slc1a3
UniProt Synonym Gene Names
Eaat1; Gmt1; GLAST-1
Uniprot Description
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7903437, PubMed:28032905). Functions as a symporter that transports one amino acid molecule together with two or three Na+ ions and one proton, in parallel with the counter-transport of one K+ ion (). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (PubMed:15363892, PubMed:15390100,PubMed:16880397).
Research Articles on Slc1a3
Similar Products
Product Notes
The Slc1a3 slc1a3 (Catalog #AAA718462) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 146-237. The amino acid sequence is listed below: HPGKGTKENM YREGKIVQVT AADAFLDLIR NMFPPNLVEA CFKQFKTSYE KRSFKVPIQS NETLLGAVIN NVSEAMETLT RIREEMVPVP GS. It is sometimes possible for the material contained within the vial of "Excitatory amino acid transporter 1 (Slc1a3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
