Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Solute carrier family 15 member 1 (SLC15A1) Recombinant Protein | SLC15A1 recombinant protein

Recombinant Human Solute carrier family 15 member 1 (SLC15A1), partial

Gene Names
SLC15A1; PEPT1; HPECT1; HPEPT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Solute carrier family 15 member 1 (SLC15A1); Recombinant Human Solute carrier family 15 member 1 (SLC15A1); partial; SLC15A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
383-584. Partial (Partial of Extracellular)
Sequence
DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQ
Sequence Length
584
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,806 Da
NCBI Official Full Name
solute carrier family 15 member 1
NCBI Official Synonym Full Names
solute carrier family 15 member 1
NCBI Official Symbol
SLC15A1
NCBI Official Synonym Symbols
PEPT1; HPECT1; HPEPT1
NCBI Protein Information
solute carrier family 15 member 1
UniProt Protein Name
Solute carrier family 15 member 1
Protein Family
UniProt Gene Name
SLC15A1
UniProt Synonym Gene Names
PEPT1

NCBI Description

This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs. [provided by RefSeq, Apr 2010]

Uniprot Description

Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.

Research Articles on SLC15A1

Similar Products

Product Notes

The SLC15A1 slc15a1 (Catalog #AAA962501) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 383-584. Partial (Partial of Extracellular). The amino acid sequence is listed below: DKTLPVFPKG NEVQIKVLNI GNNTMNISLP GEMVTLGPMS QTNAFMTFDV NKLTRINISS PGSPVTAVTD DFKQGQRHTL LVWAPNHYQV VKDGLNQKPE KGENGIRFVN TFNELITITM SGKVYANISS YNASTYQFFP SGIKGFTISS TEIPPQCQPN FNTFYLEFGS AYTYIVQRKN DSCPEVKVFE DISANTVNMA LQ . It is sometimes possible for the material contained within the vial of "Solute carrier family 15 member 1 (SLC15A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.