Chaperone protein skp (skp) Recombinant Protein | skp recombinant protein

Recombinant Escherichia coli Chaperone protein skp (skp)

Cat. Num. AAA1108648

• Gene Names: skp; ECK0177; hlpA; JW0173; ompH
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Chaperone protein skp (skp); Recombinant Escherichia coli Chaperone protein skp (skp); skp recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-161, full length protein
• Sequence: ADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK
• Sequence Length: 141

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128171
• NCBI GeneID: 944861
• NCBI Accession #: NP_414720.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AEU7; P11457
• Molecular Weight: 17,688 Da
• NCBI Official Full Name: periplasmic chaperone
• NCBI Official Symbol: skp
• NCBI Official Synonym Symbols: ECK0177; hlpA; JW0173; ompH
• NCBI Protein Information: periplasmic chaperone
• UniProt Protein Name: Chaperone protein Skp
• Protein Family: Chaperone protein
• UniProt Gene Name: skp
• UniProt Synonym Gene Names: hlpA; ompH

NCBI Description

The reported binding to DNA was an artifact due to the cationic nature of Skp. [More information is available at EcoGene: EG10455]. Skp is a periplasmic protein chaperone that binds to unfolded outer membrane proteins. [More information is available at EcoCyc: EG10455].

Uniprot Description

Molecular chaperone that interacts specifically with outer membrane proteins, thus maintaining the solubility of early folding intermediates during passage through the periplasm. Required for the efficient release of OmpA from the inner membrane, the maintenance of its solubility in the periplasm, and, in association with lipopolysaccharide (LPS), for the efficient folding and insertion of OmpA into the outer membrane.