Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Selection and upkeep of intraepithelial T-cells protein 3 (Skint3) Recombinant Protein | Skint3 recombinant protein

Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 3 (Skint3)

Gene Names
Skint3; Skint-3; RP23-29D6.1; A430090E18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Selection and upkeep of intraepithelial T-cells protein 3 (Skint3); Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 3 (Skint3); Recombinant Selection and upkeep of intraepithelial T-cells protein 3 (Skint3); Selection and upkeep of intraepithelial T-cells protein 3; Skint-3; Skint3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-458
Sequence
SEQFTITGLERPVLAPLGGILELSCQLSPPQNAQQMEIRWFRNRYTEPVYLYRNGKDLHGETISKYVERTELLKHDIGKGKVTLRVFKVTVDDDGSYHCVFKDGIFYEEHITEVKVTATSSDIKIIMHPPNIKGVMLECHSRGWFPQPHMEWRDSNGQVIPATSKSQSQDENKLFNMTMNLFADVGLHQIVTCYIQNLLTHQEESISIVLTGDLFSWKIDWILILSIIACVMIPYSMTSYLQQHLIHGSCSQRSHHWRKNAMVCMSSVIAIIGSMLILHLKQRVPISDQHFELDTLYLEDISVILCVVIVFNLKLNLLTYYRLERKYDGCTPGCKACFYILKIIIIILPFVFTFGCYNAIFLKYHQLQKKVSIPDPLYYFYTSWLVNMEMLGVFLVFFPTFINLIEFSQFIKTVPKPIWLCQENMREDDAIRHR
Sequence Length
458
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,068 Da
NCBI Official Full Name
selection and upkeep of intraepithelial T-cells protein 3 isoform a
NCBI Official Synonym Full Names
selection and upkeep of intraepithelial T cells 3
NCBI Official Symbol
Skint3
NCBI Official Synonym Symbols
Skint-3; RP23-29D6.1; A430090E18Rik
NCBI Protein Information
selection and upkeep of intraepithelial T-cells protein 3; skint 3
UniProt Protein Name
Selection and upkeep of intraepithelial T-cells protein 3
UniProt Gene Name
Skint3
UniProt Synonym Gene Names
Skint-3
UniProt Entry Name
SKIT3_MOUSE

Uniprot Description

Function: May act by engaging a cell surface molecule on immature T-cells in the embryonic thymus

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed in skin and thymus. Ref.1

Miscellaneous: Encoded by one of the 11 copies of Skint genes clustered in the D1 region of the chromosome 4.

Sequence similarities: Belongs to the SKINT family.Contains 1 Ig-like C1-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Similar Products

Product Notes

The Skint3 skint3 (Catalog #AAA1116606) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-458. The amino acid sequence is listed below: SEQFTITGLE RPVLAPLGGI LELSCQLSPP QNAQQMEIRW FRNRYTEPVY LYRNGKDLHG ETISKYVERT ELLKHDIGKG KVTLRVFKVT VDDDGSYHCV FKDGIFYEEH ITEVKVTATS SDIKIIMHPP NIKGVMLECH SRGWFPQPHM EWRDSNGQVI PATSKSQSQD ENKLFNMTMN LFADVGLHQI VTCYIQNLLT HQEESISIVL TGDLFSWKID WILILSIIAC VMIPYSMTSY LQQHLIHGSC SQRSHHWRKN AMVCMSSVIA IIGSMLILHL KQRVPISDQH FELDTLYLED ISVILCVVIV FNLKLNLLTY YRLERKYDGC TPGCKACFYI LKIIIIILPF VFTFGCYNAI FLKYHQLQKK VSIPDPLYYF YTSWLVNMEM LGVFLVFFPT FINLIEFSQF IKTVPKPIWL CQENMREDDA IRHR. It is sometimes possible for the material contained within the vial of "Selection and upkeep of intraepithelial T-cells protein 3 (Skint3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.