E3 ubiquitin-protein ligase sina (sina) Recombinant Protein | sina recombinant protein
Recombinant Drosophila melanogaster E3 ubiquitin-protein ligase sina (sina)
Gene Names
sina; anon-EST:fe2H7; CG9949; DmelCG9949; sia; Sina; SINA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase sina (sina); Recombinant Drosophila melanogaster E3 ubiquitin-protein ligase sina (sina); sina recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-314, Full length protein
Sequence
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV
Sequence Length
314
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,707 Da
NCBI Official Full Name
seven in absentia, isoform C
NCBI Official Synonym Full Names
seven in absentia
NCBI Official Symbol
sina
NCBI Official Synonym Symbols
anon-EST:fe2H7; CG9949; DmelCG9949; sia; Sina; SINA
NCBI Protein Information
CG9949 gene product from transcript CG9949-RA
UniProt Protein Name
E3 ubiquitin-protein ligase sina
Protein Family
UniProt Gene Name
sina
Uniprot Description
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk) (PubMed:9267026, PubMed:9267027, PubMed:11526076, PubMed:12215542, PubMed:18160715). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:12215542). Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons (PubMed:9267026, PubMed:9267027, PubMed:11526076, PubMed:12215542). Also involved in external sensory organ development (PubMed:11526076).
Research Articles on sina
1. Sina may be involved in regulating the levels of developmentally important transcription factors.
Similar Products
Product Notes
The sina sina (Catalog #AAA1017118) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-314, Full length protein. The amino acid sequence is listed below: MSNKINPKRR EPTAAAAGAG ATGVATNTST STGSSSAGNT SSANTSSSSS SSLSSAGGGD AGMSADLTSL FECPVCFDYV LPPILQCSSG HLVCVSCRSK LTCCPTCRGP LANIRNLAME KVASNVKFPC KHSGYGCTAS LVYTEKTEHE ETCECRPYLC PCPGASCKWQ GPLDLVMQHL MMSHKSITTL QGEDIVFLAT DINLPGAVDW VMMQSCFGHH FMLVLEKQEK YDGHQQFFAI VQLIGSRKEA ENFVYRLELN GNRRRLTWEA MPRSIHEGVA SAIHNSDCLV FDTSIAQLFA DNGNLGINVT ISLV. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase sina (sina), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
