Rabbit anti-Human TriMethyl-Histone H3-K36 Monoclonal Antibody | anti-H3-K36 antibody

TriMethyl-Histone H3-K36 Rabbit mAb

Cat. Num. AAA28630

• Reactivity: Human
• Applications: Western Blot, Dot Blot, Immunohistochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: TriMethyl-Histone H3-K36, Antibody; TriMethyl-Histone H3-K36 Rabbit mAb; H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36; anti-H3-K36 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY

• Applicable Applications for anti-H3-K36 antibody: Western Blot (WB), Dot Blot (DB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq
• Application Notes: WB: 1:500-1:1000; DB: 1:500-1:1000; IHC-P: 1:100-1:500; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.; ChIP: 5ug antibody for 5ug-10ug of Chromatin; ChIP-seq: 1:50-1:100
• Cross Reactivity: Human, Mouse, Rat, Other (Wide Range Predicted)
• Immunogen: A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
• Modification: TriMethyl K36
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (AAA28630) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 600 ug extracts of 293F cells using 5 ug TriMethyl-Histone H3-K36 antibody (AAA28630). Western blot was performed from the immunoprecipitate using TriMethyl-Histone H3-K36 antibody (AAA28630) at a dilution of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

DB (Dot Blot)

(Dot-blot analysis of all sorts of peptides using TriMethyl-Histone H3-K36 antibody (AAA28630) at 1:1000 dilution.)

WB (Western Blot)

(Western blot analysis of various lysates using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and H3K36me3 Rabbit mAb (AAA28630). The ChIP sequencing results indicate the enrichment pattern of H3K36me3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.)

Related Product Information for anti-H3-K36 antibody

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Product Categories/Family for anti-H3-K36 antibody

Signal Transduction; MAPK-Erk Signaling Pathway; MAPK-P38 Signaling Pathway; Epigenetics & Nuclear Signaling; Epigenetic Modifications; Methylation; Methylated Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4504299
• NCBI GeneID: 8290/8350
• NCBI Accession #: NP_003484.1
• NCBI GenBank Nucleotide #: NM_003493.2
• UniProt Accession #: Q16695; P68431
• Molecular Weight: Calculated MW: 15kDa
• UniProt Protein Name: Histone H3.1t
• UniProt Gene Name: HIST3H3
• UniProt Synonym Gene Names: H3FT; H3/t; H3t
• UniProt Entry Name: H31T_HUMAN