Sigma non-opioid intracellular receptor 1 (Sigmar1) Recombinant Protein | Sigmar1 recombinant protein

Recombinant Mouse Sigma non-opioid intracellular receptor 1 (Sigmar1), partial

Cat. Num. AAA1253104

• Gene Names: Sigmar1; Oprs1; Sig1R; sigma1R
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sigma non-opioid intracellular receptor 1 (Sigmar1); Recombinant Mouse Sigma non-opioid intracellular receptor 1 (Sigmar1); partial; Sigmar1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 31-80
• Sequence: GTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ
• Sequence Length: 223

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 557786225
• NCBI GeneID: 18391
• NCBI Accession #: NP_001273467.1
• NCBI GenBank Nucleotide #: NM_001286538.1
• UniProt Accession #: O55242; Q9JKU9
• Molecular Weight: 21,633 Da
• NCBI Official Full Name: sigma non-opioid intracellular receptor 1 isoform 2
• NCBI Official Synonym Full Names: sigma non-opioid intracellular receptor 1
• NCBI Official Symbol: Sigmar1
• NCBI Official Synonym Symbols: Oprs1; Sig1R; sigma1R
• NCBI Protein Information: sigma non-opioid intracellular receptor 1
• UniProt Protein Name: Sigma non-opioid intracellular receptor 1
• Protein Family: Sigma non-opioid intracellular receptor
• UniProt Gene Name: Sigmar1
• UniProt Synonym Gene Names: Oprs1; Sigma1-receptor; Sigma1R

NCBI Description

This gene encodes a transmembrane protein located in the endoplasmic reticulum. The encoded protein is a receptor that binds several endogenous ligands, including N,N-dimethyltryptamine, progesterone and pregnenolone and a variety of of non-opiate compounds. The encoded protein plays a role in regulating the activity of ion channels, acting as a chaperone and protecting cells from oxidative stress. In humans, this receptor has been associated with Alzheimer's and Parkinson's diseases, stroke and numerous disease conditions such as depression, pain and addiction. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2013]

Uniprot Description

Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane (PubMed:12730355). Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration (PubMed:11149946, PubMed:14622179, PubMed:15571673, PubMed:15777781, PubMed:23332758, PubMed:9425306, PubMed:9603192). Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria (PubMed:25678561).