E3 ubiquitin-protein ligase SIAH2 (SIAH2) Recombinant Protein | SIAH2 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase SIAH2 (SIAH2)

Cat. Num. AAA1264671

• Gene Names: SIAH2; hSiah2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 ubiquitin-protein ligase SIAH2 (SIAH2); Recombinant Human E3 ubiquitin-protein ligase SIAH2 (SIAH2); SIAH2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-324, Full length protein
• Sequence: MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
• Sequence Length: 324

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for SIAH2 recombinant protein

This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia.

NCBI and Uniprot Product Information

• NCBI GI #: 31982899
• NCBI GeneID: 6478
• NCBI Accession #: NP_005058.3
• NCBI GenBank Nucleotide #: NM_005067.6
• UniProt Accession #: O43255; O43270
• Molecular Weight: 34,615 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase SIAH2
• NCBI Official Synonym Full Names: siah E3 ubiquitin protein ligase 2
• NCBI Official Symbol: SIAH2
• NCBI Official Synonym Symbols: hSiah2
• NCBI Protein Information: E3 ubiquitin-protein ligase SIAH2
• UniProt Protein Name: E3 ubiquitin-protein ligase SIAH2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: SIAH2
• UniProt Synonym Gene Names: Siah-2; hSiah2

NCBI Description

This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. [provided by RefSeq, Jul 2008]

Uniprot Description

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (POU2AF1, PML, NCOR1), a cell surface receptor (DCC), an antiapoptotic protein (BAG1), and a protein involved in synaptic vesicle function in neurons (SYP). Mediates ubiquitination and proteasomal degradation of DYRK2 in response to hypoxia. It is thereby involved in apoptosis, tumor suppression, cell cycle, transcription and signaling processes. Has some overlapping function with SIAH1. Triggers the ubiquitin-mediated degradation of TRAF2, whereas SIAH1 does not. Promotes monoubiquitination of SNCA.