E3 ubiquitin-protein ligase SIAH1 (Siah1) Recombinant Protein | Siah1 recombinant protein

Recombinant Rat E3 ubiquitin-protein ligase SIAH1 (Siah1)

Cat. Num. AAA1470734

• Gene Names: Siah1; SIAH; Siah1a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 ubiquitin-protein ligase SIAH1 (Siah1); Recombinant Rat E3 ubiquitin-protein ligase SIAH1 (Siah1); Siah1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-282, full length protein
• Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
• Sequence Length: 282

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Siah1 recombinant protein

This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

NCBI and Uniprot Product Information

• NCBI GI #: 82880666
• NCBI GeneID: 140941
• NCBI Accession #: NP_543181.2
• NCBI GenBank Nucleotide #: NM_080905.2
• UniProt Accession #: Q920M9; Q06984
• Molecular Weight: 31,137 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase SIAH1
• NCBI Official Synonym Full Names: siah E3 ubiquitin protein ligase 1
• NCBI Official Symbol: Siah1
• NCBI Official Synonym Symbols: SIAH; Siah1a
• NCBI Protein Information: E3 ubiquitin-protein ligase SIAH1
• UniProt Protein Name: E3 ubiquitin-protein ligase SIAH1
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: Siah1
• UniProt Synonym Gene Names: Siah1a; Siah-1

NCBI Description

synaptophysin binding protein and function as E3 ubiquitin-protein ligases to regulate the ubiquitination and degradation of synaptophysin [RGD, Feb 2006]

Uniprot Description

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3 (). Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.