Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

High osmolarity signaling protein SHO1 (SHO1) Recombinant Protein | SHO1 recombinant protein

Recombinant Ajellomyces capsulata High osmolarity signaling protein SHO1 (SHO1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High osmolarity signaling protein SHO1 (SHO1); Recombinant Ajellomyces capsulata High osmolarity signaling protein SHO1 (SHO1); Recombinant High osmolarity signaling protein SHO1 (SHO1); High osmolarity signaling protein SHO1; Osmosensor SHO1; SHO1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-325
Sequence
MVTYSANYSTSFQKRSPFAVHNRRSNMARMDFNNIVGDPFALITISTSLIAWLLSFATCVISDIQGAFPNFAWWAVGYMLCAIIGISLVLASQTSHVYGVAIVGYLAAGLTFTTLAVNSLIYDDQASKQAGAAGFILQSMVTIVWIFYFGSSSQTSSRPYLDSMGAGKEHPSYRNSKPLSTNYGARPETVVSGNQPPQMYTSAQLNGFETSSPVSGYPPTAANGAENGTQNRFVGPAIGSQSNLGGGSTLGADHPSTPNEVSQPTVYPYRAKAIYSYEANPDDANEISFSKHEILDVSDVSGRWWQAKKASGETGIAPSNYLILI
Sequence Length
325
Species
Ajellomyces capsulata (strain H143) (Darling's disease fungus) (Histoplasma capsulatum)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
34,875 Da
UniProt Protein Name
High osmolarity signaling protein SHO1
UniProt Gene Name
SHO1
UniProt Entry Name
SHO1_AJECH

Uniprot Description

Function: Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity

By similarity.

Subunit structure: Forms homooligomers

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the SHO1 family.Contains 1 SH3 domain.

Similar Products

Product Notes

The High osmolarity signaling protein SHO1 (SHO1) sho1 (Catalog #AAA1218992) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-325. The amino acid sequence is listed below: MVTYSANYST SFQKRSPFAV HNRRSNMARM DFNNIVGDPF ALITISTSLI AWLLSFATCV ISDIQGAFPN FAWWAVGYML CAIIGISLVL ASQTSHVYGV AIVGYLAAGL TFTTLAVNSL IYDDQASKQA GAAGFILQSM VTIVWIFYFG SSSQTSSRPY LDSMGAGKEH PSYRNSKPLS TNYGARPETV VSGNQPPQMY TSAQLNGFET SSPVSGYPPT AANGAENGTQ NRFVGPAIGS QSNLGGGSTL GADHPSTPNE VSQPTVYPYR AKAIYSYEAN PDDANEISFS KHEILDVSDV SGRWWQAKKA SGETGIAPSN YLILI. It is sometimes possible for the material contained within the vial of "High osmolarity signaling protein SHO1 (SHO1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.