Serine/threonine-protein kinase Sgk1 (sgk1) Recombinant Protein | sgk1 recombinant protein
Recombinant Xenopus tropicalis Serine/threonine-protein kinase Sgk1 (sgk1)
Gene Names
sgk1; Sgk; sgk1-a; sgk1-b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase Sgk1 (sgk1); Recombinant Xenopus tropicalis Serine/threonine-protein kinase Sgk1 (sgk1); sgk1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-418, Full length protein
Sequence
MRTKNEKSPLKAFMKQRRMGLNDFIQKIATNSSYACKHSEVQSILNISPPQEPELLNENSSPPPSPSQQINLGPSSNPHAKPSDFQFLKIIGKGSFGKVLLARHNADEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTTSRLYFILDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARNLLEGLLQKDRTKRIGAKNDFMEIKNHMFFSPINWDDLINKKITPPFNPNVSGPSDLQHFDPEFTEEPVPNSIGQSPDSILITASIKEAAEAFMGFSYAPPMESYL
Sequence Length
418
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,659 Da
NCBI Official Full Name
serine/threonine-protein kinase Sgk1
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase 1
NCBI Official Symbol
sgk1
NCBI Official Synonym Symbols
Sgk; sgk1-a; sgk1-b
NCBI Protein Information
serine/threonine-protein kinase Sgk1
UniProt Protein Name
Serine/threonine-protein kinase Sgk1
Protein Family
UniProt Gene Name
sgk1
UniProt Synonym Gene Names
sgk
Uniprot Description
Protein kinase that may play an important role in cellular stress response (). Plays an important role in activating certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion.
Similar Products
Product Notes
The sgk1 sgk1 (Catalog #AAA1459482) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-418, Full length protein. The amino acid sequence is listed below: MRTKNEKSPL KAFMKQRRMG LNDFIQKIAT NSSYACKHSE VQSILNISPP QEPELLNENS SPPPSPSQQI NLGPSSNPHA KPSDFQFLKI IGKGSFGKVL LARHNADEKF YAVKVLQKKA ILKKKEEKHI MSERNVLLKN VKHPFLVGLH FSFQTTSRLY FILDYINGGE LFYHLQRERC FLEPRARFYA AEIASALGYL HSLNIVYRDL KPENILLDSQ GHIILTDFGL CKENIEPNGT TSTFCGTPEY LAPEVLHKQP YDRTVDWWCL GAVLYEMLYG LPPFYSRNTA EMYDNILNKP LQLKPNITNS ARNLLEGLLQ KDRTKRIGAK NDFMEIKNHM FFSPINWDDL INKKITPPFN PNVSGPSDLQ HFDPEFTEEP VPNSIGQSPD SILITASIKE AAEAFMGFSY APPMESYL. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase Sgk1 (sgk1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
