Protein SEY1 (SEY1) Recombinant Protein | SEY1 recombinant protein
Recombinant Saccharomyces cerevisiae Protein SEY1 (SEY1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SEY1 (SEY1); Recombinant Saccharomyces cerevisiae Protein SEY1 (SEY1); SEY1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-776aa; full length protein
Sequence
MADRPAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNT NFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFER KAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIR DHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQ DVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVAR FKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYM EKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEK EFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHV IHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAW RTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVF EVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQF RRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFV IHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SEY1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
89,432 Da
NCBI Official Full Name
dynamin-like GTPase SEY1
NCBI Official Symbol
SEY1
NCBI Protein Information
dynamin-like GTPase SEY1
UniProt Protein Name
Protein SEY1
Protein Family
UniProt Gene Name
SEY1
UniProt Entry Name
SEY1_YEAST
Uniprot Description
Cooperates with the reticulon proteins RTN1 and RTN2 and the tubule-shaping DP1 family protein YOP1 to generate and maintain the structure of the tubular endoplasmic reticulum network. Has GTPase activity, which is required for its function in ER organization.
Research Articles on SEY1
Similar Products
Product Notes
The SEY1 sey1 (Catalog #AAA7029644) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-776aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SEY1 sey1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADRPAIQLI DEEKEFHQSA LQYFQQCIGN RDVGLDYHVI SVFGSQSSGK STLLNVLFNT NFDTMDAQVK RQQTTKGIWL AHTKQVNTTI EIDNDRPDIF VLDVEGSDGS ERGEDQDFER KAALFAIAVS EVLIVNMWEQ QIGLYQGNNM ALLKTVFEVN LSLFGKNDND HKVLLLFVIR DHVGVTPLSS LSDSVTRELE KIWTELSKPA GCEGSSLYDY FDLKFVGLAH KLLQEDKFTQ DVKKLGDSFV MKGTENYYFK PQYHHRLPLD GWTMYAENCW DQIERNKDLD LPTQQILVAR FKTEEISNEA LEEFISKYDE SIAPLKGNLG SLTSQLVKLK EECLTKYDEQ ASRYARNVYM EKREALNTKL NSHISGTINE FLESLMEKLW DDLKLEVSSR DKATTSFVES VAAGKSKIEK EFNESMETFK KLGLLISNEE ITCKFSDDIE ERIKQLRDAE LKAKIGRIKK NLVPELKDHV IHLLSHPSKK VWDDIMNDFE STIKDNISAY QVEKDKYDFK IGLSESENAK IYKNIRILAW RTLDTTVHDY LKIDTIVSIL RDRFEDVFRY DAEGSPRLWK TEEEIDGAFR VAKEHALEVF EVLSLAVTSD NVEIIPDVPM AEEESGEDNE IYRDNEGVFH SRRFAHILTE LQKENVLDQF RRQINITVLD SKRSIITTRT HIPPWIYVLL AVLGWNEFVA VIRNPLFVTL TLILGATFFV IHKFGLWGPV VNVVQSAVGE TRTAIKDKLR QFVVEDHEVK ESFEMKDFSK NEQKEK. It is sometimes possible for the material contained within the vial of "Protein SEY1 (SEY1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
