Kallistatin (SERPINA4) Recombinant Protein | SERPINA4 recombinant protein

Recombinant Human Kallistatin (SERPINA4)

Cat. Num. AAA966437

• Gene Names: SERPINA4; KAL; KST; PI4; KLST; PI-4; kallistatin
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kallistatin (SERPINA4); Recombinant Human Kallistatin (SERPINA4); SERPINA4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-427, Full length protein
• Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP
• Sequence Length: 407

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 573459706
• NCBI GeneID: 5267
• NCBI Accession #: NP_001275961.1
• NCBI GenBank Nucleotide #: NM_001289032.1
• UniProt Accession #: P29622; Q53XB5; Q86TR9; Q96BZ5
• Molecular Weight: 48,542 Da
• NCBI Official Full Name: kallistatin isoform 1
• NCBI Official Synonym Full Names: serpin family A member 4
• NCBI Official Symbol: SERPINA4
• NCBI Official Synonym Symbols: KAL; KST; PI4; KLST; PI-4; kallistatin
• NCBI Protein Information: kallistatin
• UniProt Protein Name: Kallistatin
• Protein Family: Kallistatin
• UniProt Gene Name: SERPINA4
• UniProt Synonym Gene Names: KST; PI4; PI-4

Uniprot Description

Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.