Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Z Dependent Protease Inhibitor (ZPI) Recombinant Protein | ZPI recombinant protein

Recombinant Protein Z Dependent Protease Inhibitor (ZPI)

Gene Names
Serpina10; Rasp1
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Protein Z Dependent Protease Inhibitor (ZPI); Recombinant Protein Z Dependent Protease Inhibitor (ZPI); ZPI recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-SLFLP VLLAEVWLVS SFNLSSHSPE APIRLVSQDY ENQTWEEYEW ADPRDDNEYW LRASQQLSNE TSSFGFSLLR KISMRHDGNV IFSPFGLSVA MVNLMLGAKG ETKVQVENGL NLQAL
Sequence Length
436
Applicable Applications for ZPI recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
Ser6~Leu125 (Accession # Q62975) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.3kDa
NCBI Official Full Name
protein Z-dependent protease inhibitor
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
NCBI Official Symbol
Serpina10
NCBI Official Synonym Symbols
Rasp1
NCBI Protein Information
protein Z-dependent protease inhibitor; PZI; RASP-1; serpin A10; PZ-dependent protease inhibitor; regeneration-associated serpin 1; serpin peptidase inhibitor, clade A, member 10; plasma protein associated with liver regeneration; serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
UniProt Protein Name
Protein Z-dependent protease inhibitor
UniProt Gene Name
Serpina10
UniProt Synonym Gene Names
Rasp1; Zpi; PZ-dependent protease inhibitor; PZI; RASP-1
UniProt Entry Name
ZPI_RAT

NCBI Description

may be involved in liver regenerationn [RGD, Feb 2006]

Uniprot Description

Function: Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Also inhibits factor XIa in the absence of cofactors

By similarity.

Subcellular location: Secreted.

Tissue specificity: Expressed by the liver and secreted in plasma. Ref.1

Developmental stage: In regenerating livers, it showed maximal expression 48 hours after hepatectomy, expression remaining elevated up to 2 weeks after liver removal. Ref.1

Miscellaneous: Heparin acts as an important cofactor, producing 20 to 100-fold accelerations of SERPINA10 reactions with factor Xa and factor XIa

By similarity.

Sequence similarities: Belongs to the serpin family.

Similar Products

Product Notes

The ZPI serpina10 (Catalog #AAA2009837) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Protein Z Dependent Protease Inhibitor (ZPI) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the ZPI serpina10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-SLFLP VLLAEVWLVS SFNLSSHSPE APIRLVSQDY ENQTWEEYEW ADPRDDNEYW LRASQQLSNE TSSFGFSLLR KISMRHDGNV IFSPFGLSVA MVNLMLGAKG ETKVQVENGL NLQAL. It is sometimes possible for the material contained within the vial of "Protein Z Dependent Protease Inhibitor (ZPI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.