Tyramine receptor ser-2 (ser-2) Recombinant Protein | ser-2 recombinant protein
Recombinant Tyramine receptor ser-2 (ser-2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tyramine receptor ser-2 (ser-2); Recombinant Tyramine receptor ser-2 (ser-2); Tyramine receptor ser-2; ser-2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-455
Sequence
MFRNYTDSVQEMVLRAIDSIRDSVINASSAVSTTTLPPLDIPMTSMKPPSIIPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQRRRRMSAQP
Sequence Length
432
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,870 Da
NCBI Official Full Name
Protein SER-2, isoform a
NCBI Official Symbol
ser-2
NCBI Protein Information
Protein SER-2
UniProt Protein Name
Tyramine receptor ser-2
Protein Family
UniProt Gene Name
ser-2
UniProt Entry Name
SER2_CAEEL
Uniprot Description
Function: G-protein coupled receptor for tyramine, a known neurotransmitter and neuromodulator and direct precursor of octopamine. The rank order of potency is tyramine > octopamine > dopamine > serotonin > epinephrine = norepinephrine. Ref.2
Subcellular location: Cell membrane; Multi-pass membrane protein.
Tissue specificity: The different isoforms are expressed in specific, but overlapping sets of sensory, inter- and motor neurons, including AIY, AIZ and RIA interneurons. They are also expressed in pharyngeal cells, head muscles and excretory gland cells. Ref.3
Disruption phenotype: A loss-of-function mutation does not affect the development of AIY interneurons, or lead to egg-laying or any other behavioral defects. Ref.3
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Research Articles on ser-2
Similar Products
Product Notes
The ser-2 ser-2 (Catalog #AAA1093023) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-455. The amino acid sequence is listed below: MFRNYTDSVQ EMVLRAIDSI RDSVINASSA VSTTTLPPLD IPMTSMKPPS IIPTVELVLG TITYLVIIAM TVVGNTLVVV AVFSYRPLKK VQNYFLVSLA ASDLAVAIFV MPLHVVTFLA GGKWLLGVTV CQFFTTADIL LCTSSILNLC AIALDRYWAI HNPINYAQKR TTKFVCIVIV IVWILSMLIS VPPIIGWNNW QENMMEDSCG LSTEKAFVVF SAAGSFFLPL LVMVVVYVKI FISARQRIRT NRGRSALMRI QNAEGDDDYR KMSIKRASVE SARTSSRVGE KTPLVIADGQ TTVTTLAAHS TDGGSLPKDE TTKHMKYHNN GSCKVKVKDV KEDEGNPNPT AVLRKREKIS VAKEKRAAKT IAVIIFVFSF CWLPFFVAYV IRPFCETCKL HAKVEQAFTW LGYINSSLNP FLYGILNLEF RRAFKKILCP KAVLEQRRRR MSAQP. It is sometimes possible for the material contained within the vial of "Tyramine receptor ser-2 (ser-2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
