26S proteasome complex subunit DSS1 (SHFM1) Recombinant Protein | SHFM1 recombinant protein

Recombinant Human 26S proteasome complex subunit DSS1 (SHFM1)

Cat. Num. AAA952957

• Gene Names: SEM1; ECD; DSS1; SHFD1; SHFM1; SHSF1; Shfdg1; C7orf76
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 26S proteasome complex subunit DSS1 (SHFM1); Recombinant Human 26S proteasome complex subunit DSS1 (SHFM1); SHFM1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-70, Full length protein
• Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
• Sequence Length: 70

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for SHFM1 recombinant protein

The product of this gene has been localized within the split hand
split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand
split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle.

NCBI and Uniprot Product Information

• NCBI GI #: 5453640
• NCBI GeneID: 7979
• NCBI Accession #: NP_006295.1
• NCBI GenBank Nucleotide #: NM_006304.1
• UniProt Accession #: P60896; Q13437; Q61067; Q6ZVN7
• Molecular Weight: 14,085 Da
• NCBI Official Full Name: 26S proteasome complex subunit SEM1 isoform 3
• NCBI Official Synonym Full Names: SEM1, 26S proteasome complex subunit
• NCBI Official Symbol: SEM1
• NCBI Official Synonym Symbols: ECD; DSS1; SHFD1; SHFM1; SHSF1; Shfdg1; C7orf76
• NCBI Protein Information: 26S proteasome complex subunit SEM1
• UniProt Protein Name: 26S proteasome complex subunit SEM1
• Protein Family: 26S proteasome complex
• UniProt Gene Name: SEM1

NCBI Description

The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair (PubMed:15117943). Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388). The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and thus transcription-associated genomic instability. R-loop accumulation increases in SEM1-depleted cells.