Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Secretion monitor (secM) Recombinant Protein | secM recombinant protein

Recombinant Escherichia coli Secretion monitor (secM)

Gene Names
secM; ECK0098; JW5007; srrA; yacA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secretion monitor (secM); Recombinant Escherichia coli Secretion monitor (secM); secM recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-170, full length protein
Sequence
AEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLT
Sequence Length
133
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,880 Da
NCBI Official Full Name
regulator of secA translation
NCBI Official Symbol
secM
NCBI Official Synonym Symbols
ECK0098; JW5007; srrA; yacA
NCBI Protein Information
regulator of secA translation
UniProt Protein Name
Secretion monitor
Protein Family
UniProt Gene Name
secM
UniProt Synonym Gene Names
srrA; yacA

NCBI Description

Translation and secretion of SecM regulates downstream secA gene expression. [More information is available at EcoGene: EG11087]. SecM regulates production of co-translated SecA; reduced secretion of SecM acts as a "sensor" that stimulates translation of the SecA translocation factor via a translational pause at Pro166 that is caused by an arrest sequence that interacts with the ribosomal exit tunnel . [More information is available at EcoCyc: EG11087].

Uniprot Description

Regulates secA expression by translational coupling of the secM secA operon. Ribosomes translating the C-terminal region of secM can disrupt an RNA repressor helix that normally blocks secA translation initiation, derepressing the expression of secA. Translational pausing of secM at Pro-166 under secretion-limiting conditions increases the duration of the disruption and thus increases secA expression. This is controlled by interaction of the secM signal peptide with secA and the translocon, possibly by secA pulling the paused secM out of the ribosome. The arrest sequence (150-FXXXXWIXXXXGIRAGP-166) is sufficient to cause arrest of unrelated proteins. Elongation arrest can be alleviated by mutations in the 23S rRNA or in ribosomal protein L22.

Research Articles on secM

Similar Products

Product Notes

The secM secm (Catalog #AAA1027672) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-170, full length protein. The amino acid sequence is listed below: AEPNAPAKAT TRNHEPSAKV NFGQLALLEA NTRRPNSNYS VDYWHQHAIR TVIRHLSFAM APQTLPVAEE SLPLQAQHLA LLDTLSALLT QEGTPSEKGY RIDYAHFTPQ AKFSTPVWIS QAQGIRAGPQ RLT. It is sometimes possible for the material contained within the vial of "Secretion monitor (secM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.