Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein-export membrane protein SecG (secG) Recombinant Protein | secG recombinant protein

Recombinant Escherichia coli Protein-export membrane protein SecG (secG)

Gene Names
secG; ECK3164; JW3142; prlH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-export membrane protein SecG (secG); Recombinant Escherichia coli Protein-export membrane protein SecG (secG); Recombinant Protein-export membrane protein SecG (secG); Protein-export membrane protein SecG; P12 Preprotein translocase band 1 subunit; secG recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-110
Sequence
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
Sequence Length
110
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,365 Da
NCBI Official Full Name
preprotein translocase membrane subunit
NCBI Official Symbol
secG
NCBI Official Synonym Symbols
ECK3164; JW3142; prlH
NCBI Protein Information
preprotein translocase membrane subunit
UniProt Protein Name
Protein-export membrane protein SecG
Protein Family
UniProt Gene Name
secG
UniProt Entry Name
SECG_ECOLI

NCBI Description

SecYEG complex interacts with SecDFyajC to form a hexameric holocomplex. [More information is available at EcoGene: EG12095]. SecG is an inner membrane protein involved in the Sec protein secretion pathway. [More information is available at EcoCyc: EG12095].

Uniprot Description

Function: Subunit of the protein translocation channel SecYEG. Overexpression of some hybrid proteins has been thought to jam the protein secretion apparatus resulting in cell death; while this may be true it also results in FtsH-mediated degradation of SecY. Treatment with antibiotics that block translation elongation such as chloramphenicol also leads to degradation of SecY and SecE but not SecG.

Subunit structure: Component of the Sec protein translocase complex. Heterotrimer consisting of SecY, SecE and SecG subunits. The heterotrimers can form oligomers, although 1 heterotrimer is thought to be able to translocate proteins. SecG probably contacts ribosomal protein L23 and/or L29 when the translocation complex is docked with the ribosome.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Post-translational modification: The N-terminus is blocked.

Sequence similarities: Belongs to the SecG family.

Research Articles on secG

Similar Products

Product Notes

The secG secg (Catalog #AAA1194823) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-110. The amino acid sequence is listed below: MYEALLVVFL IVAIGLVGLI MLQQGKGADM GASFGAGASA TLFGSSGSGN FMTRMTALLA TLFFIISLVL GNINSNKTNK GSEWENLSAP AKTEQTQPAA PAKPTSDIPN. It is sometimes possible for the material contained within the vial of "Protein-export membrane protein SecG (secG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.