SEC14-like protein 2 (SEC14L2) Recombinant Protein | SEC14L2 recombinant protein

Recombinant Human SEC14-like protein 2 (SEC14L2)

Cat. Num. AAA1151202

• Gene Names: SEC14L2; SPF; TAP; TAP1; C22orf6
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: SEC14-like protein 2 (SEC14L2); Recombinant Human SEC14-like protein 2 (SEC14L2); SEC14L2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-403, Full length protein
• Sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK
• Sequence Length: 403

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for SEC14L2 recombinant protein

This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 323639472
• NCBI GeneID: 23541
• NCBI Accession #: NP_001191133.1
• NCBI GenBank Nucleotide #: NM_001204204.2
• UniProt Accession #: O76054; Q53EQ2; Q6PD61; Q9ULN4; B7Z8Q1; F5H3U4
• Molecular Weight: 36,636 Da
• NCBI Official Full Name: SEC14-like protein 2 isoform 3
• NCBI Official Synonym Full Names: SEC14 like lipid binding 2
• NCBI Official Symbol: SEC14L2
• NCBI Official Synonym Symbols: SPF; TAP; TAP1; C22orf6
• NCBI Protein Information: SEC14-like protein 2
• UniProt Protein Name: SEC14-like protein 2
• Protein Family: SEC14-like protein
• UniProt Gene Name: SEC14L2
• UniProt Synonym Gene Names: C22orf6; KIAA1186; KIAA1658; TAP; hTAP; SPF

NCBI Description

This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell.