Short-chain dehydrogenase/reductase family 9C member 7 (SDR9C7) Recombinant Protein | SDR9C7 recombinant protein
Recombinant Bovine Short-chain dehydrogenase/reductase family 9C member 7 (SDR9C7)
Gene Names
SDR9C7; SDR-O
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Short-chain dehydrogenase/reductase family 9C member 7 (SDR9C7); Recombinant Bovine Short-chain dehydrogenase/reductase family 9C member 7 (SDR9C7); SDR9C7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-313, Full length protein
Sequence
MAAISDLSFMYRWFKNCNLVRNLSDKYVFITGCDSGFGNLLARQLVDRGMRVLAACFTKEGAQKLQQDTSYQLQTILLDVTKTESIKAATQWVRDQVGEQGLWALVNNAGVGLPSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKKARGRVVNMSSSGGRVAVIGGGYCISKFGVEAFSDSIRRELHYFGVKVSIIEPGNFRTAILGKDGLEKHMRKLWERLPPETRESYGEEYFRIYTDNLKSTMQLADPRISEVTNSMEHAIVSRSPRIRYNPGLDAKLLYLPLAKFPTPVTDFILSRYLPRPADSV
Sequence Length
313
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,191 Da
NCBI Official Full Name
short-chain dehydrogenase/reductase family 9C member 7
NCBI Official Synonym Full Names
short chain dehydrogenase/reductase family 9C member 7
NCBI Official Symbol
SDR9C7
NCBI Official Synonym Symbols
SDR-O
NCBI Protein Information
short-chain dehydrogenase/reductase family 9C member 7
UniProt Protein Name
Short-chain dehydrogenase/reductase family 9C member 7
Protein Family
UniProt Gene Name
SDR9C7
UniProt Synonym Gene Names
RDHS; SDRO; SDR-O
Uniprot Description
Displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity ().
Similar Products
Product Notes
The SDR9C7 sdr9c7 (Catalog #AAA1177681) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-313, Full length protein. The amino acid sequence is listed below: MAAISDLSFM YRWFKNCNLV RNLSDKYVFI TGCDSGFGNL LARQLVDRGM RVLAACFTKE GAQKLQQDTS YQLQTILLDV TKTESIKAAT QWVRDQVGEQ GLWALVNNAG VGLPSGPNEW LTKEDFVKVI NVNLVGLIEV TLHMLPMVKK ARGRVVNMSS SGGRVAVIGG GYCISKFGVE AFSDSIRREL HYFGVKVSII EPGNFRTAIL GKDGLEKHMR KLWERLPPET RESYGEEYFR IYTDNLKSTM QLADPRISEV TNSMEHAIVS RSPRIRYNPG LDAKLLYLPL AKFPTPVTDF ILSRYLPRPA DSV. It is sometimes possible for the material contained within the vial of "Short-chain dehydrogenase/reductase family 9C member 7 (SDR9C7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
