Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Killing factor sdpC (sdpC) Recombinant Protein | sdpC recombinant protein

Recombinant Bacillus subtilis Killing factor sdpC (sdpC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Killing factor sdpC (sdpC); Recombinant Bacillus subtilis Killing factor sdpC (sdpC); sdpC recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-203, Full length protein
Sequence
KENHTFSGEDYFRGLLFGQGEVGKLISNDLDPKLVKEANSTEGKKLVNDVVKFIKKDQPQYMDELKQSIDSKDPKKLIENMTKADQLIQKYAKKNENVKYSSNKVTPSCGLYAVCVAAGYLYVVGVNAVALQTAAAVTTAVWKYVAKYSSSASNNSDLEAAAAKTLKLIHQ
Sequence Length
171
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,221 Da
NCBI Official Full Name
killing factor SdpC
NCBI Official Symbol
spbC
NCBI Protein Information
killing factor SdpC
UniProt Protein Name
Sporulation delaying protein C
UniProt Gene Name
sdpC
UniProt Synonym Gene Names
SDP

Uniprot Description

Produces a 42-residue extracellular sporulation delaying protein (SDP) that collapses the proton motive force (probably both the membrane potential and pH gradient) across the cell membrane, which leads to autolysis; may form a proton channel (PubMed:22469514). Induces the lysis of other B.subtilis cells that have not entered the sporulation pathway, inducing cannibalism to provide a source of nutrients to support sporulation, and at the same time delaying commitment to the energetically expensive and irreversible onset of sporulation (PubMed:12817086). Addition of SDP to liquid cultures halts growth, leads to increased cell permeability and eventually cell lysis in a significant subset of the population, although some cells survive and resume growth after a lag period (PubMed:20805502). Effects of SDP are irreversible within 10 minutes (PubMed:22469514). Addition of SDP to solid cultures induces killing, it is much more effective than SKF (AC O31422) (PubMed:20805502). Has antibiotic action against Gram-positive Firmicutes (L.acidophilus, M.megaterium, P.polymyxa, S.aureus, S.epidermidis) but not Actinobacteria M.luteus or Gram-negative P.aeruginosa or K.pneumoniae (PubMed:20805502, PubMed:22469514). SDP induces expression of the sdpR-sdpI operon (PubMed:12817086). Its maturation is dependent on SdpA and SdpB. Also functions as a ligand, binds to SdpI triggering a signal transduction cascade that protects the cell against the toxic effects of its own SDP.

Research Articles on sdpC

Similar Products

Product Notes

The sdpC sdpc (Catalog #AAA1107670) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-203, Full length protein. The amino acid sequence is listed below: KENHTFSGED YFRGLLFGQG EVGKLISNDL DPKLVKEANS TEGKKLVNDV VKFIKKDQPQ YMDELKQSID SKDPKKLIEN MTKADQLIQK YAKKNENVKY SSNKVTPSCG LYAVCVAAGY LYVVGVNAVA LQTAAAVTTA VWKYVAKYSS SASNNSDLEA AAAKTLKLIH Q. It is sometimes possible for the material contained within the vial of "Killing factor sdpC (sdpC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.