Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Secretin receptor (SCTR) Recombinant Protein | SCTR recombinant protein

Recombinant Human Secretin receptor (SCTR)

Gene Names
SCTR; SR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secretin receptor (SCTR); Recombinant Human Secretin receptor (SCTR); Recombinant Secretin receptor (SCTR); Secretin receptor; SCT-R; SCTR recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-440
Sequence
HSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
Sequence Length
440
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,207 Da
NCBI Official Full Name
secretin receptor
NCBI Official Synonym Full Names
secretin receptor
NCBI Official Symbol
SCTR
NCBI Official Synonym Symbols
SR
NCBI Protein Information
secretin receptor; pancreatic secretin receptor
UniProt Protein Name
Secretin receptor
Protein Family
UniProt Gene Name
SCTR
UniProt Synonym Gene Names
SCT-R
UniProt Entry Name
SCTR_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. [provided by RefSeq, Jul 2008]

Uniprot Description

SCTR: This is a receptor for secretin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 2; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q14.1

Cellular Component: integral to plasma membrane; cytoplasmic microtubule; plasma membrane

Molecular Function: secretin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; digestion; excretion

Research Articles on SCTR

Similar Products

Product Notes

The SCTR sctr (Catalog #AAA947954) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-440. The amino acid sequence is listed below: HSTGALPRLC DVLQVLWEEQ DQCLQELSRE QTGDLGTEQP VPGCEGMWDN ISCWPSSVPG RMVEVECPRF LRMLTSRNGS LFRNCTQDGW SETFPRPNLA CGVNVNDSSN EKRHSYLLKL KVMYTVGYSS SLVMLLVALG ILCAFRRLHC TRNYIHMHLF VSFILRALSN FIKDAVLFSS DDVTYCDAHR AGCKLVMVLF QYCIMANYSW LLVEGLYLHT LLAISFFSER KYLQGFVAFG WGSPAIFVAL WAIARHFLED VGCWDINANA SIWWIIRGPV ILSILINFIL FINILRILMR KLRTQETRGN EVSHYKRLAR STLLLIPLFG IHYIVFAFSP EDAMEIQLFF ELALGSFQGL VVAVLYCFLN GEVQLEVQKK WQQWHLREFP LHPVASFSNS TKASHLEQSQ GTCRTSII. It is sometimes possible for the material contained within the vial of "Secretin receptor (SCTR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.