DnaJ-related protein SCJ1 (SCJ1) Recombinant Protein | SCJ1 recombinant protein
Recombinant Saccharomyces cerevisiae DnaJ-related protein SCJ1 (SCJ1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ-related protein SCJ1 (SCJ1); Recombinant Saccharomyces cerevisiae DnaJ-related protein SCJ1 (SCJ1); SCJ1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-377, full length protein
Sequence
QDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKLAQCPDCQGRGVIIQVLRMGIMTQQIQQMCGRCGGTGQIIKNECKTCHGKKVTKKNKFFHVDVPPGAPRNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGYGDLYIDYVVVMPKTFKSGQNMLKDEL
Sequence Length
356
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,543 Da
NCBI Official Full Name
Scj1p
NCBI Official Symbol
SCJ1
NCBI Protein Information
Scj1p
UniProt Protein Name
DnaJ-related protein SCJ1
Protein Family
UniProt Gene Name
SCJ1
UniProt Synonym Gene Names
J protein SCJ1
Uniprot Description
Regulates protein folding in the endoplasmic reticulum lumen. Probably acts as a J-protein for the Hsp70-type chaperone KAR2 by stimulating its ATP-dependent reaction cycle and initiating folding reactions. Also involved in the endoplasmic reticulum-associated degradation (ERAD) process. Cooperates with KAR2 and another J-protein JEM1 to facilitate the export of ERAD substrates to the cytoplasm by maintaining them in a translocation-competent state and preventing their aggregation in the endoplasmic reticulum lumen.
Similar Products
Product Notes
The SCJ1 scj1 (Catalog #AAA1157815) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-377, full length protein. The amino acid sequence is listed below: QDYYAILEID KDATEKEIKS AYRQLSKKYH PDKNAGSEEA HQKFIEVGEA YDVLSDPEKK KIYDQFGADA VKNGGGGGGP GGPGAGGFHD PFDIFERMFQ GGHGGPGGGF GQRQRQRGPM IKVQEKLSLK QFYSGSSIEF TLNLNDECDA CHGSGSADGK LAQCPDCQGR GVIIQVLRMG IMTQQIQQMC GRCGGTGQII KNECKTCHGK KVTKKNKFFH VDVPPGAPRN YMDTRVGEAE KGPDFDAGDL VIEFKEKDTE NMGYRRRGDN LYRTEVLSAA EALYGGWQRT IEFLDENKPV KLSRPAHVVV SNGEVEVVKG FGMPKGSKGY GDLYIDYVVV MPKTFKSGQN MLKDEL. It is sometimes possible for the material contained within the vial of "DnaJ-related protein SCJ1 (SCJ1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
