Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuroendocrine protein 7B2 (Scg5) Recombinant Protein | Scg5 recombinant protein

Recombinant Mouse Neuroendocrine protein 7B2 (Scg5)

Gene Names
Scg5; 7B2; Sgne1; Sgne-1; AI325031
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuroendocrine protein 7B2 (Scg5); Recombinant Mouse Neuroendocrine protein 7B2 (Scg5); Scg5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-212, Full length protein
Sequence
YSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEAE
Sequence Length
186
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,866 Da
NCBI Official Full Name
neuroendocrine protein 7B2
NCBI Official Synonym Full Names
secretogranin V
NCBI Official Symbol
Scg5
NCBI Official Synonym Symbols
7B2; Sgne1; Sgne-1; AI325031
NCBI Protein Information
neuroendocrine protein 7B2
UniProt Protein Name
Neuroendocrine protein 7B2
Protein Family
UniProt Gene Name
Scg5
UniProt Synonym Gene Names
Sgne-1; Sgne1

Uniprot Description

Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.

Research Articles on Scg5

Similar Products

Product Notes

The Scg5 scg5 (Catalog #AAA965750) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-212, Full length protein. The amino acid sequence is listed below: YSPRTPDRVS ETDIQRLLHG VMEQLGIARP RVEYPAHQAM NLVGPQSIEG GAHEGLQHLG PFGNIPNIVA ELTGDNIPKD FSEDQGYPDP PNPCPLGKTA DDGCLENAPD TAEFSREFQL DQHLFDPEHD YPGLGKWNKK LLYEKMKGGQ RRKRRSVNPY LQGKRLDNVV AKKSVPHFSE EEKEAE. It is sometimes possible for the material contained within the vial of "Neuroendocrine protein 7B2 (Scg5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.