Acyl-CoA desaturase (SCD) Recombinant Protein | SCD recombinant protein
Recombinant Bovine Acyl-CoA desaturase (SCD)
Gene Names
SCD; SCD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-CoA desaturase (SCD); Recombinant Bovine Acyl-CoA desaturase (SCD); SCD recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-359aa; full length protein
Sequence
PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAHR LWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDET FQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bovine
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SCD recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,705 Da
NCBI Official Full Name
acyl-CoA desaturase
NCBI Official Symbol
SCD
NCBI Official Synonym Symbols
SCD1
NCBI Protein Information
acyl-CoA desaturase
UniProt Protein Name
Acyl-CoA desaturase
Protein Family
UniProt Gene Name
SCD
UniProt Synonym Gene Names
Delta-9 desaturase
UniProt Entry Name
ACOD_BOVIN
Uniprot Description
Stearyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA (). Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation (). Plays an important role in body energy homeostasis (). Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides ().
Research Articles on SCD
Similar Products
Product Notes
The SCD scd (Catalog #AAA7029308) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-359aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SCD scd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAHLLQEEIS SSYTTTTTIT APPSRVLQNG GGKLEKTPLY LEEDIRPEMR DDIYDPTYQD KEGPKPKLEY VWRNIILMSL LHLGALYGIT LIPTCKIYTY IWVLFYYLMG ALGITAGAHR LWSHRTYKAR LPLRVFLIIG NTMAFQNDVF EWSRDHRAHH KFSETDADPH NSRRGFFFSH VGWLLVRKHP AVKEKGSTLN LSDLRAEKLV MFQRRYYKPG VLLLCFILPT LVPWYLWDET FQNSLFFATL FRYALGLNVT WLVNSAAHMY GYRPYDKTIN PRENILVSLG AAGEGFHNYH HTFPYDYSAS EYRWHINFTT FFIDCMAAIG LAYDRKKVSK AAILARIKRT GEESYKSG. It is sometimes possible for the material contained within the vial of "Acyl-CoA desaturase (SCD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
