Peptide transport system permease protein sapC (sapC) Recombinant Protein | sapC recombinant protein
Recombinant Escherichia coli Peptide transport system permease protein sapC (sapC)
Gene Names
sapC; ECK1287; JW1285
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptide transport system permease protein sapC (sapC); Recombinant Escherichia coli Peptide transport system permease protein sapC (sapC); Recombinant Peptide transport system permease protein sapC (sapC); Peptide transport system permease protein sapC; sapC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296
Sequence
MPYDSVYSEKRPPGTLRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLGYQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFVVTLAATICGLVLGTFAGATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSMVHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE
Sequence Length
296
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,548 Da
NCBI Official Full Name
antimicrobial peptide transport ABC transporter permease
NCBI Official Symbol
sapC
NCBI Official Synonym Symbols
ECK1287; JW1285
NCBI Protein Information
antimicrobial peptide transport ABC transporter permease
UniProt Protein Name
Peptide transport system permease protein SapC
Protein Family
UniProt Gene Name
sapC
UniProt Entry Name
SAPC_ECOLI
NCBI Description
Characterized initially in Salmonella. [More information is available at EcoGene: EG20256]. SapABCDF (Sensitive to antimicrobial peptides) is a member of the ATP Binding Cassette (ABC) transporter superfamily . [More information is available at EcoCyc: G2000].
Uniprot Description
Function: Involved in a peptide intake transport system that plays a role in the resistance to antimicrobial peptides.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. OppBC subfamily.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The sapC sapc (Catalog #AAA1250208) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296. The amino acid sequence is listed below: MPYDSVYSEK RPPGTLRTAW RKFYSDASAM VGLYGCAGLA VLCIFGGWFA PYGIDQQFLG YQLLPPSWSR YGEVSFFLGT DDLGRDVLSR LLSGAAPTVG GAFVVTLAAT ICGLVLGTFA GATHGLRSAV LNHILDTLLA IPSLLLAIIV VAFAGPSLSH AMFAVWLALL PRMVRSIYSM VHDELEKEYV IAARLDGAST LNILWFAVMP NITAGLVTEI TRALSMAILD IAALGFLDLG AQLPSPEWGA MLGDALELIY VAPWTVMLPG AAIMISVLLV NLLGDGVRRA IIAGVE. It is sometimes possible for the material contained within the vial of "Peptide transport system permease protein sapC (sapC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
