Candidapepsin-3 (SAP3) Recombinant Protein | SAP3 recombinant protein
Recombinant Candida albicans Candidapepsin-3 (SAP3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Candidapepsin-3 (SAP3); Recombinant Candida albicans Candidapepsin-3 (SAP3); SAP3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
59-398, Full length
Sequence
QTVPVKLINEQVSYASDITVGSNKQKLTVVIDTGSSDLWVPDSQVSCQAGQGQDPNFCKNEGTYSPSSSSSSQNLNSPFSIEYGDGTTSQGTWYKDTIGFGGISITKQQFADVTSTSVDQGILGIGYKTHEAEGNYDNVPVTLKNQGIISKNAYSLYLNSRQATSGQIIFGGVDNAKYSGTLIALPVTSDNELRIHLNTVKVAGQSINADVDVLLDSGTTITYLQQGVADQVISAFNGQETYDANGNLFYLVDCNLSGSVDFAFDKNAKISVPASEFTAPLYTEDGQVYDQCQLLFGTSDYNILGDNFLRSAYIVYDLDDNEISLAQVKYTTASNIAALT
Sequence Length
340
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,806 Da
NCBI Official Full Name
Sap3p
NCBI Official Symbol
SAP3
NCBI Protein Information
Sap3p
UniProt Protein Name
Candidapepsin-3
Protein Family
UniProt Gene Name
SAP3
Uniprot Description
Secreted aspartic peptidases (SAPs) are a group of ten acidic hydrolases considered as key virulence factors. These enzymes supply the fungus with nutrient amino acids as well as are able to degrade the selected host's proteins involved in the immune defense. Induces host inflammatory cytokine production in a proteolytic activity-independent way. Plays a role in tissue damage during superficial infection. Moreover, acts toward human hemoglobin though limited proteolysis to generate a variety of antimicrobial hemocidins, enabling to compete with the other microorganisms of the same physiological niche using the microbicidal peptides generated from the host protein.
Similar Products
Product Notes
The SAP3 sap3 (Catalog #AAA1045465) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 59-398, Full length. The amino acid sequence is listed below: QTVPVKLINE QVSYASDITV GSNKQKLTVV IDTGSSDLWV PDSQVSCQAG QGQDPNFCKN EGTYSPSSSS SSQNLNSPFS IEYGDGTTSQ GTWYKDTIGF GGISITKQQF ADVTSTSVDQ GILGIGYKTH EAEGNYDNVP VTLKNQGIIS KNAYSLYLNS RQATSGQIIF GGVDNAKYSG TLIALPVTSD NELRIHLNTV KVAGQSINAD VDVLLDSGTT ITYLQQGVAD QVISAFNGQE TYDANGNLFY LVDCNLSGSV DFAFDKNAKI SVPASEFTAP LYTEDGQVYD QCQLLFGTSD YNILGDNFLR SAYIVYDLDD NEISLAQVKY TTASNIAALT. It is sometimes possible for the material contained within the vial of "Candidapepsin-3 (SAP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
