Switch-activating protein 1 (sap1) Recombinant Protein | sap1 recombinant protein
Recombinant Schizosaccharomyces pombe Switch-activating protein 1 (sap1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Switch-activating protein 1 (sap1); Recombinant Schizosaccharomyces pombe Switch-activating protein 1 (sap1); sap1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-254, Full length
Sequence
MEAPKMELKSYKRKNASLSPSSSPAKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLSELQQYREKFLVGKRKCDCNDEINERLKKLTEEQQNVDMLVAKVNFLSKHLHDNEEKLMQVNAKMDEVLAENKRLQQLLDHNDLLSKLEPPSAYAPHGVNMGTNMGANMGANMNAIRGGLHSSISPNLGDH
Sequence Length
254
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,127 Da
NCBI Official Full Name
switch-activating protein Sap1
NCBI Official Symbol
sap1
NCBI Protein Information
switch-activating protein Sap1
UniProt Protein Name
Switch-activating protein 1
Protein Family
UniProt Gene Name
sap1
Uniprot Description
Binds to sequences required for mating-type switching. Makes a simultaneous contact with both the alpha and beta domains of the switch-activating site SAS1. Also binds to replication fork barrier 1 (RFB1) located within a 78 base pair sequence near the 3' end of the rRNA coding region. This leads to replication fork blockage. It binds the consensus sequence 5'-TA[AG]GCAGNTN[CT]AACG[AC]G-3'.Has a role in chromosome organization and integrity where it is involved in chromosome segregation. Has a role in sister chromatid cohesion and condensation.Miscellaneous: Present with 20000 molecules/cell in log phase SD medium.
Research Articles on sap1
Similar Products
Product Notes
The sap1 sap1 (Catalog #AAA1122906) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-254, Full length. The amino acid sequence is listed below: MEAPKMELKS YKRKNASLSP SSSPAKAQRT HLSLEEKIKL MRLVVRHKHE LVDRKTSEFY AKIARIGYED EGLAIHTESA CRNQIISIMR VYEQRLAHRQ PGMKTTPEED ELDQLCDEWK ARLSELQQYR EKFLVGKRKC DCNDEINERL KKLTEEQQNV DMLVAKVNFL SKHLHDNEEK LMQVNAKMDE VLAENKRLQQ LLDHNDLLSK LEPPSAYAPH GVNMGTNMGA NMGANMNAIR GGLHSSISPN LGDH. It is sometimes possible for the material contained within the vial of "Switch-activating protein 1 (sap1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
