Probable N-acetyltransferase san (san) Recombinant Protein | san recombinant protein
Recombinant Drosophila melanogaster Probable N-acetyltransferase san (san)
Gene Names
san; atado; CG12352; DmAAF34715; DmelCG12352; Naa50; NAA50; span
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable N-acetyltransferase san (san); Recombinant Drosophila melanogaster Probable N-acetyltransferase san (san); san recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-184, Full length protein
Sequence
MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVLQKTLRRTAPNSNSTATSTTANSNSRSKARQFTFV
Sequence Length
184
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,994 Da
NCBI Official Full Name
separation anxiety
NCBI Official Synonym Full Names
separation anxiety
NCBI Official Symbol
san
NCBI Official Synonym Symbols
atado; CG12352; DmAAF34715; DmelCG12352; Naa50; NAA50; span
NCBI Protein Information
CG12352 gene product from transcript CG12352-RA
UniProt Protein Name
Probable N-acetyltransferase san
Protein Family
UniProt Gene Name
san
UniProt Synonym Gene Names
span
Uniprot Description
N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine (). Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides (). Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins. Autoacetylates (PubMed:14653991). Required for the establishment of sister chromatid cohesion and couple the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together (PubMed:14653991, PubMed:18801358, PubMed:27996020). Required for the interaction between Scc1/vtd and SMC3, possibly by mediating N-terminal acetylation of Scc1/vtd (PubMed:27996020).
Research Articles on san
Similar Products
Product Notes
The san san (Catalog #AAA1485553) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-184, Full length protein. The amino acid sequence is listed below: MTRSSIELGD VTPHNIKQLK KLNTVVFPVS YNDKFYVDVL EAGELAKLAY YNDIVVGAVC CRIDNTENQR RLYIMTLGCL SPYRRLGIGT VMFEHIMNFA EKDGNFDSIF LHVQINNNGA IEFYKKFGFE IVDTKEQYYK RIEPADAHVL QKTLRRTAPN SNSTATSTTA NSNSRSKARQ FTFV. It is sometimes possible for the material contained within the vial of "Probable N-acetyltransferase san (san), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
