Probable CtpA-like serine protease Recombinant Protein | SACOL1455 recombinant protein

Recombinant Staphylococcus aureus Probable CtpA-like serine protease (SACOL1455)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable CtpA-like serine protease; Recombinant Staphylococcus aureus Probable CtpA-like serine protease (SACOL1455); SACOL1455 recombinant protein

Ordering
Cat. Num. AAA7040493 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

1-496aa; full length protein

Sequence

MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF INQKISGLNKTDQSNLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNESTQFDKALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK

Sequence Length

Full length protein

Application Notes

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Species

Staphylococcus aureus (strain COL)

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for SACOL1455 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

446264275

NCBI Accession #

WP_000342130.1

NCBI GenBank Nucleotide #

WP_000342130.1

UniProt Accession #

Q5HG01

Molecular Weight

55,277 Da

NCBI Official Full Name

serine protease

UniProt Protein Name

Probable CtpA-like serine protease

Protein Family

Probable CtpA-like serine protease

UniProt Gene Name

SACOL1455

UniProt Entry Name

CTPAL_STAAC

Similar Products

Product Notes

The Probable CtpA-like serine protease sacol1455 (Catalog #AAA7040493) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-496aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Probable CtpA-like serine protease sacol1455 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDDKQHTSSS DDERAEIATS NQDQETNSSK RVHLKRWQFI SILIGTILIT AVITVVAYIF INQKISGLNK TDQSNLNKIE NVYKILNSDY YKKQDSDKLS KAAIDGMVKE LKDPYSEYLT KEQTKSFNEG VSGDFVGIGA EMQKKNDQIM VTSPMKGSPA ERAGIRPKDV ITKVNGKSIK GKALDEVVKD VRGKENTEVT LTVQRGSEEK DVKIKREKIH VKSVEYKKKG KVGVITINKF QNDTSGELKD AVLKAHKDGL KKIVLDLRNN PGGLLDEAVK MANIFIDKGK TVVKLEKGKD TEAIQTSNDA LKEAKDMDIS ILVNEGSASA SEVFTGALKD YNKAKVYGSK TFGKGVVQTT REFKDGSLLK YTEMKWLTPD GHYIHGKGIK PDVTIDTPKY QSLNVIPNTK TFKVGDDDKN IKTIKIGLSA LGYKVDNEST QFDKALENQV KAFQQANKLE VTGEFNKETN NKFTELLVEK ANKHDDVLDK LINILK. It is sometimes possible for the material contained within the vial of "Probable CtpA-like serine protease, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...