Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human S100 Calcium Binding Protein B/S100B Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

S100 Calcium Binding B/S100B Recombinant Protein | S100B recombinant protein

Recombinant Human S100 Calcium Binding Protein B/S100B Protein

Gene Names
S100B; NEF; S100; S100-B; S100beta
Purity
>95% by SDS-PAGE.
Synonyms
S100 Calcium Binding B/S100B; Recombinant Human S100 Calcium Binding Protein B/S100B Protein; Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-bindingprotein B; S100b; S100 beta; S100 calcium binding protein B; S100B recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PBS, 150mM NaCl, pH7.4.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Sequence Length
92
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human S100 Calcium Binding Protein B/S100B Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human S100 Calcium Binding Protein B/S100B Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for S100B recombinant protein
Description: Recombinant Human S100 Calcium Binding Protein B/S100B Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04271) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.

Background: S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B containstwo EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B playsan important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotectiveeffects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increasesfollowing brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into theblood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytesare the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominantS100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations inserum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before grosschanges develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. Inaddition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancyboth in bioptic tissue and in serum.
Product Categories/Family for S100B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
S100 calcium binding protein B
NCBI Official Synonym Full Names
S100 calcium binding protein B
NCBI Official Symbol
S100B
NCBI Official Synonym Symbols
NEF; S100; S100-B; S100beta
NCBI Protein Information
protein S100-B
UniProt Protein Name
Protein S100-B
Protein Family
UniProt Gene Name
S100B
UniProt Entry Name
S100B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq, Jul 2008]

Uniprot Description

S100B: Weakly binds calcium but binds zinc very tightly- distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain. The S100B dimer binds two molecules of STK38. Interacts with AGER. The S100B dimer interacts with two molecules of CAPZA1. Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues. Belongs to the S-101 family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: ruffle; extracellular space; cell soma; intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasm; extracellular region; nucleus

Molecular Function: identical protein binding; RAGE receptor binding; protein binding; protein homodimerization activity; zinc ion binding; calcium ion binding; tau protein binding; calcium-dependent protein binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; central nervous system development; positive regulation of apoptosis; response to glucocorticoid stimulus; memory; regulation of cell shape; cell proliferation; learning and/or memory; axonogenesis; astrocyte differentiation; response to methylmercury; positive regulation of cell proliferation; innate immune response; regulation of neuronal synaptic plasticity

Research Articles on S100B

Similar Products

Product Notes

The S100B s100b (Catalog #AAA9140130) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSELEKAMVA LIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKE QEVVDKVMET LDNDGDGECD FQEFMAFVAM VTTACHEFFE HE. It is sometimes possible for the material contained within the vial of "S100 Calcium Binding B/S100B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.