Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Relaxin receptor 1 (Rxfp1) Recombinant Protein | Rxfp1 recombinant protein

Recombinant Rat Relaxin receptor 1 (Rxfp1)

Gene Names
Rxfp1; Lgr7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Relaxin receptor 1 (Rxfp1); Recombinant Rat Relaxin receptor 1 (Rxfp1); Rxfp1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-758aa; full length protein
Sequence
MTSGPFFFCVFIIGRYFTLGNAQDVSCPLGSFPCGNISKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQLDKYFANYYKLTSTNSIEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQWNFIRTLPPNSFRKYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINHLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDYLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYLFVIGAFDLKFRGEYRKHAQPWM ESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTVAVLIFIWITGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLIRVEIPDT ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRKGTQKAYTPSFIW VEMWPLQEMSTEFMKPDAFTDPCDLSLVSRSSRLNSYS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rxfp1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,183 Da
NCBI Official Full Name
relaxin receptor 1
NCBI Official Synonym Full Names
relaxin/insulin-like family peptide receptor 1
NCBI Official Symbol
Rxfp1
NCBI Official Synonym Symbols
Lgr7
NCBI Protein Information
relaxin receptor 1
UniProt Protein Name
Relaxin receptor 1
Protein Family
UniProt Gene Name
Rxfp1
UniProt Synonym Gene Names
Lgr7
UniProt Entry Name
RXFP1_RAT

NCBI Description

G-protein coupled receptor that binds relaxin and induces cAMP production [RGD, Feb 2006]

Uniprot Description

RXFP1: Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP. Belongs to the G-protein coupled receptor 1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; hormone binding; metal ion binding

Biological Process: cell differentiation; extracellular matrix organization and biogenesis; G-protein signaling, adenylate cyclase activating pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; parturition

Research Articles on Rxfp1

Similar Products

Product Notes

The Rxfp1 rxfp1 (Catalog #AAA7029191) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-758aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rxfp1 rxfp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSGPFFFCV FIIGRYFTLG NAQDVSCPLG SFPCGNISKC LPQLLHCNGV DDCGNQADED NCGDNNGWSL QLDKYFANYY KLTSTNSIEA ETSECLVGSV PMHCLCRDLE LDCDEANLRA VPSVSSNVTV MSLQWNFIRT LPPNSFRKYH DLQKLCLQNN KIRSVSVSAF RGLHSLTKLY LSHNRITFLK PGVFEDLHRL EWLIIEDNHL SRISPLTFYG LNSLILLVLM NNALTRLPDK PLCQHMPRLH WLDFEGNRIH NLRNLTFISC NNLTVLVMRK NKINHLNEHA FTHLQKLDEL DLGSNKIENL PPNIFKDLKE LSQLNISYNP IQKIEVNQFD YLAKLKSLSL EGIEISNIQQ RMFRPLINLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE NLLASIIQRV FVWVVSAITC FGNIFVICMR PYIRSENKLH AMSIMSLCCA DCLMGVYLFV IGAFDLKFRG EYRKHAQPWM ESVHCQFMGS LAVLSTEVSV LLLTFLTLEK YICIVYPFRC LRPRKCRTVA VLIFIWITGF IVAFAPLGNK EFFKNYYGTN GVCFPLHSED TGSTGAQIYS VVIFLGINLV AFIIIVFSYG SMFYSVHQST ITATEIQKQV KKEMILAKRF FFIVFTDALC WIPIFILKFL SLIRVEIPDT ITSWVVIFIL PINSALNPII YTLTTRPFKE MIHQLWYNYR QRRSVDRKGT QKAYTPSFIW VEMWPLQEMS TEFMKPDAFT DPCDLSLVSR SSRLNSYS. It is sometimes possible for the material contained within the vial of "Relaxin receptor 1 (Rxfp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.