Reticulon-3 (RTN3) Recombinant Protein | RTN3 recombinant protein

Recombinant Human Reticulon-3 (RTN3) , partial

Cat. Num. AAA1029608

• Gene Names: RTN3; HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Reticulon-3 (RTN3); Recombinant Human Reticulon-3 (RTN3); partial; RTN3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 844-1032. Partial, provide the Reticulon Domain
• Sequence: VHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
• Sequence Length: 1032

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 388240768
• NCBI GeneID: 10313
• NCBI Accession #: NP_001252518.1
• NCBI GenBank Nucleotide #: NM_001265589.1
• UniProt Accession #: O95197; Q147U9; Q496K2; Q53GN3; Q59EP0; Q5UEP2; Q6T930; Q7RTM7; B3KQS2; B7Z308; B7Z4M0; F5H774
• Molecular Weight: 100,824 Da
• NCBI Official Full Name: reticulon-3 isoform e
• NCBI Official Synonym Full Names: reticulon 3
• NCBI Official Symbol: RTN3
• NCBI Official Synonym Symbols: HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
• NCBI Protein Information: reticulon-3
• UniProt Protein Name: Reticulon-3
• Protein Family: Reticulon
• UniProt Gene Name: RTN3
• UniProt Synonym Gene Names: ASYIP; NSPL2; HAP; NSP-like protein 2; NSP-like protein II; NSPLII

NCBI Description

This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]

Uniprot Description

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. Induces the formation of endoplasmic reticulum tubules (PubMed:25612671).