Sigma-E factor regulatory protein RseC (rseC) Recombinant Protein | rseC recombinant protein
Recombinant Escherichia coli Sigma-E factor regulatory protein RseC (rseC)
Gene Names
rseC; ECK2568; JW2554
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sigma-E factor regulatory protein RseC (rseC); Recombinant Escherichia coli Sigma-E factor regulatory protein RseC (rseC); Recombinant Sigma-E factor regulatory protein RseC (rseC); Sigma-E factor regulatory protein RseC; rseC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-159
Sequence
MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLVPGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLIARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ
Sequence Length
159
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,639 Da
NCBI Official Full Name
RseC protein involved in reduction of the SoxR iron-sulfur cluster
NCBI Official Symbol
rseC
NCBI Official Synonym Symbols
ECK2568; JW2554
NCBI Protein Information
RseC protein involved in reduction of the SoxR iron-sulfur cluster
UniProt Protein Name
Sigma-E factor regulatory protein RseC
Protein Family
UniProt Gene Name
rseC
UniProt Entry Name
RSEC_ECOLI
NCBI Description
rseC deletion does not affect sigma E activity. [More information is available at EcoGene: EG13178]. RseC plays a role in reduction of the SoxR iron-sulfur cluster, along with proteins encoded by the rsxABCDGE operon . [More information is available at EcoCyc: G7347].
Uniprot Description
Function: Seems to modulate the activity of RpoE (sigma-E).
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the RseC family.
Similar Products
Product Notes
The rseC rsec (Catalog #AAA1088185) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-159. The amino acid sequence is listed below: MIKEWATVVS WQNGQALVSC DVKASCSSCA SRAGCGSRVL NKLGPQTTHT IVVPCDEPLV PGQKVELGIA EGSLLSSALL VYMSPLVGLF LIASLFQLLF ASDVAALCGA ILGGIGGFLI ARGYSRKFAA RAEWQPIILS VALPPGLVRF ETSSEDASQ. It is sometimes possible for the material contained within the vial of "Sigma-E factor regulatory protein RseC (rseC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
