40S ribosomal protein SA (rpsa) Recombinant Protein | rpsa recombinant protein
Recombinant Xenopus laevis 40S ribosomal protein SA (rpsa)
Gene Names
rpsa.L; LR; lrp; p40; 67LR; LamR; rpsa; 37LRP; lambr; lamr1; LRP/LR; LBP/p40
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
40S ribosomal protein SA (rpsa); Recombinant Xenopus laevis 40S ribosomal protein SA (rpsa); rpsa recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-306, Full length protein
Sequence
SGGLDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPITEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKATTKEEFQGEWTAPVAEFPQAEVADWSEGVQVPSVPIQQFTAERTDVPPAPKPTEDWSTQPASTDDWSAAPTAQASEWTGTTTEWS
Sequence Length
305
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,058 Da
NCBI Official Full Name
40S ribosomal protein SA
NCBI Official Synonym Full Names
ribosomal protein SA L homeolog
NCBI Official Symbol
rpsa.L
NCBI Official Synonym Symbols
LR; lrp; p40; 67LR; LamR; rpsa; 37LRP; lambr; lamr1; LRP/LR; LBP/p40
NCBI Protein Information
40S ribosomal protein SA
UniProt Protein Name
40S ribosomal protein SA
Protein Family
UniProt Gene Name
rpsa
UniProt Synonym Gene Names
37LRP; LRP/LR; 67LR; LamR; LBP/p40
Uniprot Description
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis.
Similar Products
Product Notes
The rpsa rpsa (Catalog #AAA1408847) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-306, Full length protein. The amino acid sequence is listed below: SGGLDVLQMK EEDVLKFLAA GTHLGGTNLD FQMEQYIYKR KSDGIYIINL KRTWEKLLLA ARAIVAIENP ADVCVISSRN TGQRAVLKFA SASGATPIAG RFTPGTFTNQ IQAAFREPRL LVVTDPRADH QPITEASYVN IPTIALCNTD SPLRYVDIAI PCNNKGAHSV GLMWWMLARE VLRMRGTISR EHPWEVMPDL YFYRDPEEIE KEEQAAAEKA TTKEEFQGEW TAPVAEFPQA EVADWSEGVQ VPSVPIQQFT AERTDVPPAP KPTEDWSTQP ASTDDWSAAP TAQASEWTGT TTEWS. It is sometimes possible for the material contained within the vial of "40S ribosomal protein SA (rpsa), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
