Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

40S ribosomal protein S6 (RPS6) Recombinant Protein | RPS6 recombinant protein

Recombinant Human 40S ribosomal protein S6 (RPS6), partial

Gene Names
RPS6; S6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
40S ribosomal protein S6 (RPS6); Recombinant Human 40S ribosomal protein S6 (RPS6); partial; Phosphoprotein NP33 (Small ribosomal subunit protein eS6); RPS6 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-229aa, Partial
Sequence
EVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIA
Species
Homo sapiens (Human)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for RPS6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,681 Da
NCBI Official Full Name
40S ribosomal protein S6
NCBI Official Synonym Full Names
ribosomal protein S6
NCBI Official Symbol
RPS6
NCBI Official Synonym Symbols
S6
NCBI Protein Information
40S ribosomal protein S6; phosphoprotein NP33
UniProt Protein Name
40S ribosomal protein S6
Protein Family
UniProt Gene Name
RPS6
UniProt Entry Name
RS6_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

S6: May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA. Belongs to the ribosomal protein S6e family.

Protein type: Translation

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: polysome; small ribosomal subunit; membrane; perinuclear region of cytoplasm; dendrite; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex; cytosol

Molecular Function: protein binding; structural constituent of ribosome; protein kinase binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; erythrocyte development; TOR signaling pathway; translation; viral reproduction; positive regulation of apoptosis; T cell differentiation in the thymus; gastrulation; translational termination; viral infectious cycle; glucose homeostasis; oogenesis stage; T cell proliferation during immune response; translational initiation; ribosomal small subunit assembly and maintenance; viral transcription; activated T cell apoptosis; placenta development; mitosis; mitotic cell cycle checkpoint; ribosomal small subunit biogenesis and assembly; translational elongation; cellular protein metabolic process; mRNA catabolic process, nonsense-mediated decay; insulin receptor signaling pathway; gene expression; rRNA processing; G1/S transition of mitotic cell cycle; negative regulation of apoptosis

Research Articles on RPS6

Similar Products

Product Notes

The RPS6 rps6 (Catalog #AAA9018523) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-229aa, Partial. The amino acid sequence is listed below: EVAADALGEE WKGYVVRISG GNDKQGFPMK QGVLTHGRVR LLLSKGHSCY RPRRTGERKR KSVRGCIVDA NLSVLNLVIV KKGEKDIPGL TDTTVPRRLG PKRASRIRKL FNLSKEDDVR QYVVRKPLNK EGKKPRTKAP KIQRLVTPRV LQHKRRRIAL KKQRTKKNKE EAAEYAKLLA KRMKEAKEKR QEQIA. It is sometimes possible for the material contained within the vial of "40S ribosomal protein S6 (RPS6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.