Testing Data
40S ribosomal protein S3 (RpS3) Recombinant Protein | RpS3 recombinant protein
Recombinant Drosophila melanogaster 40S ribosomal protein S3 (RpS3)
Gene Names
RpS3; 6779; CG6779; chr3R:19185518..19185701; DmelCG6779; DmRpS3; dS3; M; M(3)124; M(3)95A; M(3)B; M(3)B2; M(3)Fla; M(3)w; M(3R)w; M95A; Mw; M[[w]]; Rp S3; rps3; rpS3; Rps3; RPS3; RS3; S3; X72921
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
40S ribosomal protein S3 (RpS3); Recombinant Drosophila melanogaster 40S ribosomal protein S3 (RpS3); 40S ribosomal protein S3; RpS3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-246. Full length.
Sequence
MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
Sequence Length
246
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Testing Data
Testing Data
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31.5 kDa
NCBI Official Full Name
ribosomal protein S3, isoform A
NCBI Official Synonym Full Names
Ribosomal protein S3
NCBI Official Symbol
RpS3
NCBI Official Synonym Symbols
6779; CG6779; chr3R:19185518..19185701; DmelCG6779; DmRpS3; dS3; M; M(3)124; M(3)95A; M(3)B; M(3)B2; M(3)Fla; M(3)w; M(3R)w; M95A; Mw; M[[w]]; Rp S3; rps3; rpS3; Rps3; RPS3; RS3; S3; X72921
NCBI Protein Information
CG6779 gene product from transcript CG6779-RB; CG6779-PA; CG6779-PB; Minute(3)95A; RpS3-PA; RpS3-PB; minute; ribosomal protein S3; rps3 gene
UniProt Protein Name
40S ribosomal protein S3
Protein Family
UniProt Gene Name
RpS3
UniProt Synonym Gene Names
M(3)95A
UniProt Entry Name
RS3_DROME
Uniprot Description
Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.
Research Articles on RpS3
1. dOgg1 and RpS3 in mitochondria increase cell survival after exposure to the nitric oxide donor SNAP
Similar Products
Product Notes
The RpS3 rps3 (Catalog #AAA1128579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-246. Full length. The amino acid sequence is listed below: MNANLPISKK RKFVSDGIFK AELNEFLTRE LAEDGYSGVE VRVTPSRTEI IIMATKTQQV LGEKGRRIRE LTAMVQKRFN FETGRIELYA EKVAARGLCA IAQAESLRYK LTGGLAVRRA CYGVLRYIME SGAKGCEVVV SGKLRGQRAK SMKFVDGLMI HSGDPCNDYV ETATRHVLLR QGVLGIKVKV MLPYDPKNKI GPKKPLPDNV SVVEPKEEKI YETPETEYKI PPPSKPLDDL SEAKVL . It is sometimes possible for the material contained within the vial of "40S ribosomal protein S3 (RpS3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
