Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) Recombinant Protein | RPN2 recombinant protein
Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)
Gene Names
RPN2; RPN-II
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2); Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2); RPN2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-36, Full length protein
Sequence
NAIFSKKNFETLSEAFSVFQTLKYLAILGGVTFLAG
Sequence Length
36
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RPN2 recombinant protein
This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser
Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
3,927 Da
NCBI Official Full Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
NCBI Official Synonym Full Names
ribophorin II
NCBI Official Symbol
RPN2
NCBI Official Synonym Symbols
RPN-II
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
UniProt Gene Name
RPN2
UniProt Synonym Gene Names
RPN-II
Uniprot Description
Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Similar Products
Product Notes
The RPN2 rpn2 (Catalog #AAA959362) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-36, Full length protein. The amino acid sequence is listed below: NAIFSKKNFE TLSEAFSVFQ TLKYLAILGG VTFLAG. It is sometimes possible for the material contained within the vial of "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
