50S ribosomal protein L3 (rplC) Recombinant Protein | rplC recombinant protein

Recombinant Mycoplasma pneumoniae 50S ribosomal protein L3 (rplC)

Cat. Num. AAA1240808

• Gene Names: rplC; VXpSPT7_orf287
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 50S ribosomal protein L3 (rplC); Recombinant Mycoplasma pneumoniae 50S ribosomal protein L3 (rplC); rplC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-287, Full length protein
• Sequence: MEIRGIFGVKVGMSQVFTTNNERLPITVIYCEPNQVAGVKTEAKDKYSATLLSFDTVENKKLNKPQQGFFEKNNLKPTKHLQEIRNMTGFEMGQQITPQNLFQVGEYVDVSAISKGRGFTGAIKRWNFKIGPLGHGAGYPHRFQGSVQAGRGGASAQRVFKGKKMSGHYGHEKVTVQNLRIVGFDEANMLVLVSGAIAGPEGGVVLIRTAKKKPGVVKPIELAVQTEKAPEAKPAKLSKKKQAKELAKAQAANQQTVEAKVDTPVVEPKPTEVKKAAPVVEKKGEDK
• Sequence Length: 287

• Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 13507904
• NCBI GeneID: 877186
• NCBI Accession #: NP_109853.1
• NCBI GenBank Nucleotide #: NC_000912.1
• UniProt Accession #: P75580
• Molecular Weight: 31,247 Da
• NCBI Official Full Name: 50S ribosomal protein L3
• NCBI Official Symbol: rplC
• NCBI Official Synonym Symbols: VXpSPT7_orf287
• NCBI Protein Information: 50S ribosomal protein L3
• UniProt Protein Name: 50S ribosomal protein L3
• Protein Family: 50S ribosomal protein
• UniProt Gene Name: rplC

Uniprot Description

One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.