Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial Recombinant Protein | RPA2 recombinant protein

Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerase I subunit RPA2 (RPA2); partial; Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2); DNA-directed RNA polymerase I subunit RPA2; RNA polymerase I subunit 2; EC=2.7.7.6; RPA2 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
670-1166. Partial.
Sequence
IVASVGVFAEYNQSPRNMYQCQMAKQTMGTPYHNHQFRTDNKIYRLLFPHRPIVKTRTQVDFDIEEYPSGTNAVVAVISYTGYDLEDAMIINKSSYERGFGHGVVYKSYTHDLNESNSQSTRGIKSSVRYKFLNNVSQKDKSKIKLENIDPDGLPKIGSQLTKGKPELCIFDTLKRGAKLSKFKDSEKARIETVRVCGNDDKNPDNLSIGYTIRYSRIPVIGDKFSSRHGQKGVLSVLWPQVDMPFTENGITPDLIINPHAFPSRMTMGMLIQSMAAKSGSLRGEFKTVETFQRYDDNDIVGHFGKELLDKGFNYHGNELMYSGIFGTPLKADIFIGVVYYQRLRHMVSDKSQARGTGPIDILTHQPVKGRKKGGGIRFGEMERDSLLAHGAAYCLNDRLFRSSDYSEGFVCQNCGSILSCYVNRAIMKTQTFIPPSLDESNKDTEDKEIHMNEKVICKVCKKNSNCKKVALPFVLRFLANELASMGIKLKFTVNDF
Sequence Length
1166
Species
Euplotes octocarinatus
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
132,714 Da
NCBI Official Full Name
DNA-directed RNA polymerase I subunit RPA2
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA2
Protein Family
UniProt Gene Name
RPA2
UniProt Synonym Gene Names
RNA polymerase I subunit 2
UniProt Entry Name
RPA2_EUPOC

Uniprot Description

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft ().

Similar Products

Product Notes

The RPA2 rpa2 (Catalog #AAA1236909) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 670-1166. Partial. The amino acid sequence is listed below: IVASVGVFAE YNQSPRNMYQ CQMAKQTMGT PYHNHQFRTD NKIYRLLFPH RPIVKTRTQV DFDIEEYPSG TNAVVAVISY TGYDLEDAMI INKSSYERGF GHGVVYKSYT HDLNESNSQS TRGIKSSVRY KFLNNVSQKD KSKIKLENID PDGLPKIGSQ LTKGKPELCI FDTLKRGAKL SKFKDSEKAR IETVRVCGND DKNPDNLSIG YTIRYSRIPV IGDKFSSRHG QKGVLSVLWP QVDMPFTENG ITPDLIINPH AFPSRMTMGM LIQSMAAKSG SLRGEFKTVE TFQRYDDNDI VGHFGKELLD KGFNYHGNEL MYSGIFGTPL KADIFIGVVY YQRLRHMVSD KSQARGTGPI DILTHQPVKG RKKGGGIRFG EMERDSLLAH GAAYCLNDRL FRSSDYSEGF VCQNCGSILS CYVNRAIMKT QTFIPPSLDE SNKDTEDKEI HMNEKVICKV CKKNSNCKKV ALPFVLRFLA NELASMGIKL KFTVNDF . It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual