Pyruvate, phosphate dikinase regulatory protein 2 (RP2) Recombinant Protein | RP2 recombinant protein
Recombinant Arabidopsis thaliana Pyruvate, phosphate dikinase regulatory protein 2 (RP2)
Gene Names
RP2; AtRP2; PPDK regulatory protein 2; T4P13.11; T4P13_11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pyruvate; phosphate dikinase regulatory protein 2 (RP2); Recombinant Arabidopsis thaliana Pyruvate; RP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-377, Full length protein
Sequence
MNLHGVSGHHEPNSEPPIPTGSSSPKLKISPKLNRWSRGRALRSGVKLDRPIPRSDNSPRRQVTEAQPTDEADKKTTAIDVEVTAGKSIYLVSDGTGWTAEHSVNAALGQFEDFSLNRGSSVNTHLFSWVEDEERLIEIIKQAAKEGAMCFYTLANPSMAKSAKQACDQLGVLSVDILGPIIEGIASHLGVSPSGLTRGAPGRVKTLNDAYFKRIEAIEFTIKQDDGTLPENLSKADIVLVGVSRTGKTPLSTYIAQKGYKVANVPFVMGVEPPRTLFQVEPRKVFGLKIQLVVLQAIRRTRVKTLGVDTEAENNYSGIDLVRKELDFASRIYERNPGWAVIDVTNKAIEETAAVILRLYHDGRDTSTTVPRISKRY
Sequence Length
377
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,386 Da
NCBI Official Full Name
PPDK regulatory protein 2
NCBI Official Symbol
RP2
NCBI Official Synonym Symbols
AtRP2; PPDK regulatory protein 2; T4P13.11; T4P13_11
NCBI Protein Information
PPDK regulatory protein 2
UniProt Protein Name
Pyruvate, phosphate dikinase regulatory protein 2
Protein Family
UniProt Gene Name
RP2
UniProt Synonym Gene Names
AtRP2; PPDK RP2; PPDK regulatory protein 2
NCBI Description
Encodes a PPDK regulatory protein that has protein kinase activity but lacks protein phosphatase activity towards PPDK (pyruvate orthophosphate dikinase).
Uniprot Description
Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Has a much lower phosphotransferase activity than PDRP1 (PubMed:21883547). Can use ADP as a high specificity substrate and GDP as a lower affinity substrate, but has no activity with UDP (PubMed:21414960).
Research Articles on RP2
Similar Products
Product Notes
The RP2 rp2 (Catalog #AAA1324932) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-377, Full length protein. The amino acid sequence is listed below: MNLHGVSGHH EPNSEPPIPT GSSSPKLKIS PKLNRWSRGR ALRSGVKLDR PIPRSDNSPR RQVTEAQPTD EADKKTTAID VEVTAGKSIY LVSDGTGWTA EHSVNAALGQ FEDFSLNRGS SVNTHLFSWV EDEERLIEII KQAAKEGAMC FYTLANPSMA KSAKQACDQL GVLSVDILGP IIEGIASHLG VSPSGLTRGA PGRVKTLNDA YFKRIEAIEF TIKQDDGTLP ENLSKADIVL VGVSRTGKTP LSTYIAQKGY KVANVPFVMG VEPPRTLFQV EPRKVFGLKI QLVVLQAIRR TRVKTLGVDT EAENNYSGID LVRKELDFAS RIYERNPGWA VIDVTNKAIE ETAAVILRLY HDGRDTSTTV PRISKRY. It is sometimes possible for the material contained within the vial of "Pyruvate, phosphate dikinase regulatory protein 2 (RP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
