Right origin-binding protein (rob) Recombinant Protein | rob recombinant protein
Recombinant Shigella flexneri Right origin-binding protein (rob)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Right origin-binding protein (rob); Recombinant Shigella flexneri Right origin-binding protein (rob); rob recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-289, Full length protein
Sequence
MDQAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDAKAGDRPINLRCELLIPIRR
Sequence Length
289
Species
Shigella flexneri
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,145 Da
NCBI Official Full Name
right oriC-binding transcriptional activator
NCBI Official Symbol
rob
NCBI Protein Information
right oriC-binding transcriptional activator
UniProt Protein Name
Right origin-binding protein
Protein Family
UniProt Gene Name
rob
Uniprot Description
Binds to the right arm of the replication origin oriC of the chromosome. Rob binding may influence the formation of the nucleoprotein structure, required for oriC function in the initiation of replication ().
Similar Products
Product Notes
The rob rob (Catalog #AAA1237517) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-289, Full length protein. The amino acid sequence is listed below: MDQAGIIRDL LIWLEGHLDQ PLSLDNVAAK AGYSKWHLQR MFKDVTGHAI GAYIRARRLS KSAVALRLTA RPILDIALQY RFDSQQTFTR AFKKQFAQTP ALYRRSPEWS AFGIRPPLRL GEFTMPEHKF VTLEDTPLIG VTQSYSCSLE QISDFRHEMR YQFWHDFLGN APTIPPVLYG LNETRPSQDK DDEQEVFYTT ALAQDQADGY VLTGHPVMLQ GGEYVMFTYE GLGTGVQEFI LTVYGTCMPM LNLTRRKGQD IERYYPAEDA KAGDRPINLR CELLIPIRR. It is sometimes possible for the material contained within the vial of "Right origin-binding protein (rob), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
