Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Electron transport complex protein RnfD (rnfD) Recombinant Protein | Maqu_0935 recombinant protein

Recombinant Marinobacter aquaeolei Electron transport complex protein RnfD (rnfD)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Electron transport complex protein RnfD (rnfD); Recombinant Marinobacter aquaeolei Electron transport complex protein RnfD (rnfD); Recombinant Electron transport complex protein RnfD (rnfD); Electron transport complex protein RnfD; Nitrogen fixation protein RnfD; Maqu_0935 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-350
Sequence
MALVQQSSPHARRARPTSRVMLWVILAALPGLLAQTLFFGWGNLINVVWCIALALGSEAAFLKLRGKPVAFFLRDNTAAVTGLLLGLSLPQFTPWWVSGIAVVSAIVVAKQLYGGLGSNPFNPAMVGYALALISFPVAMTTNWAEAATLWGGAPGFGETLAKIFTGGQTAVDGWTMATPLDEYKHKIASHTSVEVLGHPTFGDLIARGWEWVNLAFLAGGVLLIALRIITWHIPVAFLAGIAAMSLAFGSNADQYAPLQLHLLAGGTMLGAFFIATDPVSAATSHQGKLIYGAGIGVLVYLIRSWGNYPDAVAFSVLLMNFAVPFIDHYTPPRTYGHHKARRGVPGRSGG
Sequence Length
350
Species
Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845))
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,234 Da
NCBI Official Full Name
RnfABCDGE type electron transport complex subunit D
NCBI Official Symbol
Maqu_0935
NCBI Protein Information
RnfABCDGE type electron transport complex subunit D
UniProt Protein Name
Electron transport complex protein RnfD
UniProt Gene Name
rnfD
UniProt Entry Name
RNFD_MARAV

Uniprot Description

Function: Required for nitrogen fixation. May be part of a membrane complex functioning as an intermediate in the electron transport to nitrogenase

By similarity. HAMAP-Rule MF_00462

Subunit structure: Composed of at least six subunits; RnfA, RnfB, RnfC, RnfD, RnfE and RnfG

By similarity.

Subcellular location: Cell inner membrane; Multi-pass membrane protein

Potential HAMAP-Rule MF_00462.

Sequence similarities: Belongs to the NqrB/RnfD family.

Similar Products

Product Notes

The Maqu_0935 rnfd (Catalog #AAA1137942) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-350. The amino acid sequence is listed below: MALVQQSSPH ARRARPTSRV MLWVILAALP GLLAQTLFFG WGNLINVVWC IALALGSEAA FLKLRGKPVA FFLRDNTAAV TGLLLGLSLP QFTPWWVSGI AVVSAIVVAK QLYGGLGSNP FNPAMVGYAL ALISFPVAMT TNWAEAATLW GGAPGFGETL AKIFTGGQTA VDGWTMATPL DEYKHKIASH TSVEVLGHPT FGDLIARGWE WVNLAFLAGG VLLIALRIIT WHIPVAFLAG IAAMSLAFGS NADQYAPLQL HLLAGGTMLG AFFIATDPVS AATSHQGKLI YGAGIGVLVY LIRSWGNYPD AVAFSVLLMN FAVPFIDHYT PPRTYGHHKA RRGVPGRSGG. It is sometimes possible for the material contained within the vial of "Electron transport complex protein RnfD (rnfD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.