RING finger protein 32 (Rnf32) Recombinant Protein | Rnf32 recombinant protein
Recombinant Mouse RING finger protein 32 (Rnf32)
Gene Names
Rnf32; Lmbr2; 1700009J01Rik; 2700025B22Rik; 4930542N22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RING finger protein 32 (Rnf32); Recombinant Mouse RING finger protein 32 (Rnf32); Rnf32 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-368, full length protein
Sequence
MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKARKKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLAQKLGLLPPPPLPLSSDEWERVKQRSLLQGDSIQPCPICKEEFELHPQVLLSCSHVFHRACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRVKCATRIQAYWRGYIVRKWYRNLRKIIPPSDAKLRRKFFEEKFTEISHRILCSYNTNIDELFSEIDVCLAVNRSILQQLDERCGQIITKEDWEKIQAQAAHHEIYECSICLTPLSFHGDGRQAAIGTSSQRPRETVLLSCAHLFHNACLLALEEFSLGDNAPFHVCPLCRSCYQKKIVEC
Sequence Length
368
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rnf32 recombinant protein
This protein contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and
or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear.
or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,139 Da
NCBI Official Full Name
RING finger protein 32
NCBI Official Synonym Full Names
ring finger protein 32
NCBI Official Symbol
Rnf32
NCBI Official Synonym Symbols
Lmbr2; 1700009J01Rik; 2700025B22Rik; 4930542N22Rik
NCBI Protein Information
RING finger protein 32
UniProt Protein Name
RING finger protein 32
Protein Family
UniProt Gene Name
Rnf32
UniProt Synonym Gene Names
Lmbr2
Uniprot Description
May play a role in sperm formation.
Similar Products
Product Notes
The Rnf32 rnf32 (Catalog #AAA1325361) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368, full length protein. The amino acid sequence is listed below: MLRNKDRSSN KGNLAVTAVA LQDHLLHDLQ LGHLSVADPC KIKARKKEKK SKSLKRDATA IIDTGLRKST EGPNMEDPEK EYVLDPTPPP LTLAQKLGLL PPPPLPLSSD EWERVKQRSL LQGDSIQPCP ICKEEFELHP QVLLSCSHVF HRACLQAFEK FTNKKTCPLC RKNQYQTRVI HDGARLFRVK CATRIQAYWR GYIVRKWYRN LRKIIPPSDA KLRRKFFEEK FTEISHRILC SYNTNIDELF SEIDVCLAVN RSILQQLDER CGQIITKEDW EKIQAQAAHH EIYECSICLT PLSFHGDGRQ AAIGTSSQRP RETVLLSCAH LFHNACLLAL EEFSLGDNAP FHVCPLCRSC YQKKIVEC. It is sometimes possible for the material contained within the vial of "RING finger protein 32 (Rnf32), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
